KEGG   Bos taurus (cow): 281544Help
Entry
281544            CDS       T01008                                 

Gene name
TPM1
Definition
(RefSeq) tropomyosin 1 (alpha)
  KO
K10373  tropomyosin 1
Organism
bta  Bos taurus (cow)
Pathway
bta04260  Cardiac muscle contraction
bta04261  Adrenergic signaling in cardiomyocytes
bta05206  MicroRNAs in cancer
bta05410  Hypertrophic cardiomyopathy (HCM)
bta05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:bta00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    281544 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    281544 (TPM1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    281544 (TPM1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    281544 (TPM1)
   05414 Dilated cardiomyopathy (DCM)
    281544 (TPM1)
Cytoskeleton proteins [BR:bta04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     281544 (TPM1)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   281544 (TPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomyosin Tropomyosin_1 CLZ Laminin_II IncA TMF_DNA_bd DUF745 CENP-F_leu_zip Laminin_I DUF3450 DUF1664 AAA_13 XhlA ERM DUF16 Golgin_A5 ATG16 Reo_sigmaC DUF3584 SlyX DUF4472 GAS
Motif
Other DBs
NCBI-GeneID: 281544
NCBI-ProteinID: NP_001013608
BGD-bta: BT10015
UniProt: Q5KR49
Position
10
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKATEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctcaagctcgacaaggagaacgccttggat
cgagcggagcaggcggaggccgataagaaggcagcggaggacaggagcaagcagctggaa
gatgagctggtgtcgctgcaaaagaaactcaaggccaccgaagatgaactggacaaatac
tccgaggctctcaaagatgcccaggagaagctggagctggcggagaaaaaggccaccgac
gctgaagccgacgtagcttctctgaacagacgcatccagctggttgaggaagagttggat
cgtgcccaggagcgtctggcaacagctctgcagaagctggaggaggccgagaaggcagca
gatgagagtgagagaggcatgaaagtcattgagagccgagcccaaaaggatgaggagaag
atggagattcaggagatccagctgaaagaggccaaacacatcgctgaggatgccgaccgc
aagtatgaagaggtggcccgtaagctggtcatcattgagagtgacctggagcgtgcagag
gagcgggctgagctttcagaaggcaaatgtgccgagcttgaagaagagttgaaaactgtg
acgaacaacttgaaatcactggaggctcaggctgagaagtactcgcagaaggaagacaaa
tacgaggaagagatcaaggtcctttctgacaagctgaaggaggctgagactcgagctgag
tttgcggagaggtcagtaactaaattggagaaaagcattgatgacttggaagacgagctg
tacgctcagaaactgaagtacaaagccatcagcgaggagctggaccacgctctcaacgac
atgacttccatataa

DBGET integrated database retrieval system