KEGG   Bos taurus (cow): 281565Help
Entry
281565            CDS       T01008                                 

Gene name
UGP2
Definition
UDP-glucose pyrophosphorylase 2 (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bta  Bos taurus (cow)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    281565 (UGP2)
   00052 Galactose metabolism
    281565 (UGP2)
   00500 Starch and sucrose metabolism
    281565 (UGP2)
   00520 Amino sugar and nucleotide sugar metabolism
    281565 (UGP2)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     281565 (UGP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
11
AA seq 508 aa AA seqDB search
MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTAPSHEFEHTKKDLDGFRK
LFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNVSSVLNKLVVVKLNGGLGTS
MGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYDTDVPLVLMNSFNTDEDTKKILQKYNH
CRVKIYTFNQSRYPRINKESLLPVAKNVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFI
GEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKPCEFVMEVTNKTRADVKGGTLTQYEG
KLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNPKTLD
GGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSE
KREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIA
NHGDRIDIPPGAVLENKIVSGNLRILDH
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagatttgtacaagatctcagcaaggcaatgtctcaggatggtgcttctcagttc
caagaagtcattcgacaagaactagaattatctgtgaagaaggaactagaaaagatactc
accacagcaccatcacatgaatttgaacacactaaaaaagaccttgatggatttcggaag
ctatttcacagatttttgcaagaaaagggaccttctgtggattggggaaaaatccagaga
cctccggaagattcgattcagccctatgagaagataaaggccaggggcttacctgataat
gtatcttctgtgctgaacaagctggtggtggtgaaactcaatggtggtttgggaaccagc
atgggctgcaaaggcccaaagagtctgattggcgtgaggaacgagaatacctttctggat
ctgaccgttcagcaaatcgaacacttgaacaaaacctacgatactgatgttcctcttgtt
ctaatgaactcttttaacacggatgaagataccaaaaaaatactacagaagtataatcac
tgtcgtgtgaaaatctacacgtttaatcaaagcaggtacccaaggattaataaagaatcg
ttactgcctgtagcaaagaatgtatcatactcaggggaaaatacagaagcgtggtatcct
ccgggtcatggagatatttatgccagtttctacaactctggtttgctcgacacctttata
ggagaaggcaaagagtatatttttgtgtccaacatagataatctgggtgccacagtggat
ctttatattcttaatcatctcatgaacccacccaatggaaaaccttgtgaatttgtcatg
gaagtcacaaataaaacccgtgcggatgtaaagggtgggacactcactcagtatgaaggc
aaactgagactggtggaaattgctcaagtgccaaaagcgcatgttgatgagttcaaatct
gtatcaaaattcaaaatatttaacacaaacaacctatggatctctcttgctgcagttaaa
agactgcaggagcagaatgctattgacatggaaatcattgtaaatccaaagactttggat
ggaggcctgaatgttattcagttagaaactgcagtaggggctgccattaaaagttttgag
aactctctaggtattaatgttcctagaagccgttttctgcctgtcaaaaccacatcagat
ctcttgcttgtgatgtcaaacctctacagccttaatgcaggatctttgacaatgagtgaa
aagcgggaatttcctacagtgcccttggttaaattaggcagttctttcacaaaggttcag
gattatctaagaagatttgaaagtataccagatatgcttgaactggatcacctcacagtt
tcaggagatgtgacatttggcaagaatgtttcattaaagggaacggttatcatcatcgca
aatcacggtgaccgaattgacatcccacctggagcagtattagagaacaagattgtatct
gggaacctgcgtatcttggaccactga

DBGET integrated database retrieval system