KEGG   Bos taurus (cow): 281572Help
Entry
281572            CDS       T01008                                 

Gene name
VEGFA, VEGF, VEGF-A, VPF, eVEGF120, eVEGF164
Definition
vascular endothelial growth factor A
Orthology
K05448  
vascular endothelial growth factor A
Organism
bta  Bos taurus (cow)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
VEGF signaling pathway
Focal adhesion
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Pancreatic cancer
Bladder cancer
Rheumatoid arthritis
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:bta04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:bta04015]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:bta04370]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:bta04066]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:bta04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:bta04150]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:bta04060]
Cellular Processes; Cell communication; Focal adhesion [PATH:bta04510]
Human Diseases; Cancers; Pathways in cancer [PATH:bta05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:bta05206]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:bta05205]
Human Diseases; Cancers; Pancreatic cancer [PATH:bta05212]
Human Diseases; Cancers; Renal cell carcinoma [PATH:bta05211]
Human Diseases; Cancers; Bladder cancer [PATH:bta05219]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:bta05323]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23
AA seq 190 aa AA seqDB search
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGQKPHEVVKFMDVYQRSFCRPIETLVDI
FQEYPDEIEFIFKPSCVPLMRCGGCCNDESLECVPTEEFNITMQIMRIKPHQSQHIGEMS
FLQHNKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNE
RTCRCDKPRR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtacattggagccttgccttgctgctctaccttcaccat
gccaagtggtcccaggctgcacccatggcagaaggagggcagaaaccccacgaagtggtg
aagttcatggatgtctaccagcgcagcttctgccgtcccatcgagaccctggtggacatc
ttccaggagtacccagatgagattgagttcattttcaagccgtcctgtgtgcccctgatg
cggtgcgggggctgctgtaatgacgaaagtctggagtgtgtgcccactgaggagttcaac
atcaccatgcagattatgcggatcaaacctcaccaaagccagcacataggagagatgagc
ttcctacagcataacaaatgtgaatgcagaccaaagaaagataaagcaaggcaagaaaat
ccctgtgggccttgctcagagcggagaaagcatttgtttgtacaagatccgcagacgtgt
aaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagcttgagttaaacgaa
cgtacttgcagatgtgacaagccgaggcggtga

DBGET integrated database retrieval system