KEGG   Bos taurus (cow): 281572Help
Entry
281572            CDS       T01008                                 

Gene name
VEGFA, VEGF, VEGF-A, VPF, eVEGF120, eVEGF164
Definition
vascular endothelial growth factor A
Orthology
K05448  
vascular endothelial growth factor A
Organism
bta  Bos taurus (cow)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
VEGF signaling pathway
Focal adhesion
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Pancreatic cancer
Bladder cancer
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    281572 (VEGFA)
   04015 Rap1 signaling pathway
    281572 (VEGFA)
   04370 VEGF signaling pathway
    281572 (VEGFA)
   04066 HIF-1 signaling pathway
    281572 (VEGFA)
   04151 PI3K-Akt signaling pathway
    281572 (VEGFA)
   04150 mTOR signaling pathway
    281572 (VEGFA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    281572 (VEGFA)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    281572 (VEGFA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    281572 (VEGFA)
   05206 MicroRNAs in cancer
    281572 (VEGFA)
   05205 Proteoglycans in cancer
    281572 (VEGFA)
   05212 Pancreatic cancer
    281572 (VEGFA)
   05211 Renal cell carcinoma
    281572 (VEGFA)
   05219 Bladder cancer
    281572 (VEGFA)
  Immune diseases
   05323 Rheumatoid arthritis
    281572 (VEGFA)
Cytokines [BR:bta04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass I
    281572 (VEGFA)
Heparan sulfate/heparin binding proteins [BR:bta00536]
 Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
  281572 (VEGFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23
AA seq 190 aa AA seqDB search
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGQKPHEVVKFMDVYQRSFCRPIETLVDI
FQEYPDEIEFIFKPSCVPLMRCGGCCNDESLECVPTEEFNITMQIMRIKPHQSQHIGEMS
FLQHNKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNE
RTCRCDKPRR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtacattggagccttgccttgctgctctaccttcaccat
gccaagtggtcccaggctgcacccatggcagaaggagggcagaaaccccacgaagtggtg
aagttcatggatgtctaccagcgcagcttctgccgtcccatcgagaccctggtggacatc
ttccaggagtacccagatgagattgagttcattttcaagccgtcctgtgtgcccctgatg
cggtgcgggggctgctgtaatgacgaaagtctggagtgtgtgcccactgaggagttcaac
atcaccatgcagattatgcggatcaaacctcaccaaagccagcacataggagagatgagc
ttcctacagcataacaaatgtgaatgcagaccaaagaaagataaagcaaggcaagaaaat
ccctgtgggccttgctcagagcggagaaagcatttgtttgtacaagatccgcagacgtgt
aaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagcttgagttaaacgaa
cgtacttgcagatgtgacaagccgaggcggtga

DBGET integrated database retrieval system