KEGG   Bos taurus (cow): 281614Help
Entry
281614            CDS       T01008                                 

Gene name
ALCAM
Definition
(RefSeq) activated leukocyte cell adhesion molecule
  KO
K06547  
activated leukocyte cell adhesion molecule
Organism
bta  Bos taurus (cow)
Pathway
Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    281614 (ALCAM)
Cell adhesion molecules and their ligands [BR:bta04516]
 1. Immunoglobulin Superfamily
  Immune system
   Others
    ALCAM; activated leukocyte cell adhesion molecule [KO:K06547]
     281614 (ALCAM)
CD molecules [BR:bta04090]
 Proteins
  281614 (ALCAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
1
AA seq 583 aa AA seqDB search
MASKAAPSCRLVFCLLISATVLRPGLGWYTVNSAYGDTIIMPCRVDVPQNLMFGKWKYEK
PDGSPVFIAFRSSTKKSVQYDDVPEYKDRLNLSENYTLSISNAKISDEKRFVCMLVTEDD
VFEAPTVVKVFKQPSKPEIVSKAPFLETDKLKKLGECISKDSYPDGNITWYRNGKVLQAL
EGAVVIIFRKQMDSVTQLYTMTSSLEYKTTKADIQMPFTCSVTYYGPSGQKTVYSEQAVF
DIYYPTEQVTIQVLPSKNAIKEGDNITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTL
TDVKRNATGDYKCSLVDKKSMIASAAITVHYLDLSLNPSGEVTKQIGDALPVSCTISASR
NATVVWMKDNVKLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKM
TKKTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSKIIISPEEN
VTLTCTAENQLERTVNSLNVSAISIPEHDEADEISDENKEKVNDQAKLIVGIVVGLLLAA
LVAGVVYWLYMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgaaggcggccccctcctgccgtctggtcttctgcctcttgatctccgctact
gtccttaggccaggtcttggatggtatactgtaaactcagcatatggagataccattatc
atgccttgccgagttgatgtacctcagaatctcatgtttggcaaatggaaatatgaaaag
cccgatggctccccagtatttattgccttcaggtcctctacaaagaaaagtgtgcagtac
gacgatgtaccagaatacaaagacagattgaacctctcagaaaactatactctctctatc
agtaatgcaaagatcagtgatgaaaagagatttgtgtgcatgctagtaactgaggacgac
gtgtttgaggctcctacagtagtcaaggtgttcaagcaaccatcgaaacctgaaattgta
agcaaagccccatttcttgagacagacaagcttaaaaagttgggtgagtgcatttcaaaa
gacagttatccagatggcaacatcacatggtacaggaatggaaaagttctgcaagctctt
gaaggagcggtggtcataatttttagaaagcaaatggactcagtaactcagctctatacc
atgacttcatccctggagtacaagacaaccaaggctgacatacaaatgccattcacctgc
tctgtgacatattatggaccatctggccagaaaacagtttactctgaacaagcagttttt
gatatttactatcctacagagcaggtgacaatacaagtgctgccatcaaaaaatgccatc
aaagaaggggacaatatcactcttaaatgcttgggaaatggtaaccctcctcctgaggag
tttttgttttacttaccaggacagcctgaaggaattagaagttcaaatacttacacactg
acagatgtgaaacgcaatgcaacaggagactataaatgctccctggtagacaaaaaaagc
atgattgcttcagcagccatcacagttcactatttggatttgtccttaaacccaagtggg
gaggtgactaagcagattggcgatgctctgcctgtgtcatgcacaatatctgccagtagg
aatgcaactgtggtgtggatgaaagataacgtcaagcttcgatctagcccatcattttct
agtcttcattatcaggatgctggaaactatgtctgtgaaacagctctgcaagaggttgaa
ggattaaagaaaagagagtcgttgactctaattgtagaaggaaaacctcaaatcaaaatg
acaaagaaaactgatcccagtggactgtctaaaacaataatctgccatgtggaaggtttt
ccgaagccagctatacagtggacaattactggcagtggaagtgtcataaaccaaacagag
gaatctccgtatatcaatggcaggtattatagtaaaattatcatttcccctgaagagaat
gttacattaacttgcacagcagaaaaccagctggagagaacagtaaactccttgaatgtc
tctgctataagtattccagaacacgatgaggcagacgagataagtgatgaaaacaaagaa
aaggttaatgaccaggcaaaactaattgtgggaattgttgttggtctcctcctcgctgcc
ctagttgctggtgtcgtctattggctatacatgaagaaatcaaagactgcatcaaaacat
gtaaacaaggaccttggtaatatggaagaaaacaaaaagttagaagaaaacaatcacaaa
acagaagcctaa

DBGET integrated database retrieval system