KEGG   Bos taurus (cow): 281647Help
Entry
281647            CDS       T01008                                 

Gene name
XIAP, BIRC4
Definition
X-linked inhibitor of apoptosis
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
bta  Bos taurus (cow)
Pathway
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Small cell lung cancer
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:bta04120]
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:bta04064]
Cellular Processes; Cell growth and death; Apoptosis [PATH:bta04210]
Cellular Processes; Cell communication; Focal adhesion [PATH:bta04510]
Human Diseases; Cancers; Pathways in cancer [PATH:bta05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:bta05222]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:bta05166]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:bta05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
X
AA seq 497 aa AA seqDB search
MTFNSFEGSKTCVPADIDKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAIGRHRRVSPNCRFINGFYFENNAAQPTYSGVQNGQYKAENY
LGNRNHFVLERPSETHAHYLLRTGQVVDLSDTVYPRNPVMCSEEARLKSFHNWPDYAHLT
PRELARAGLYYTGIDDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNINMQSE
SSVVSSDRNFPNSTNAPINPAMADYEARIITFGTWMYSVNKEQLARAGFYALGEGDKVQC
FHCGGGLNDWKPSEDPWEQHAKWFPGCKYLLEEKGEEYVNNIHLTHSIEESLGRTVERAP
LLTEIIDDTIFQNPMVQEAIRMGFSFKDIKKTMEGKIQTSGSNYKSLEVLVADLVNAQKD
NTQDESSQTSLQKDISTEEQLRLLQEEKLCKICMDRNIAVVFIPCGHLVTCKQCAEAVDK
CPMCYTAITLRQKIFMS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggatctaaaacttgtgtacctgcagacatcgataaggat
gaagaatttgtagaagagtttaatagattaaaaacttttgctaattttccaagtagtagt
cctgtttcagcatcaacgctagcacgagctggttttctgtatactggggaaggagacact
gtgcggtgctttagttgtcatgcagcagtagatagatggcaatatggagactcagcaatt
ggaagacacaggagagtatccccaaattgcagatttatcaatggcttttattttgaaaac
aatgctgcacagcctacatattctggtgtccaaaatggtcagtacaaagctgaaaactac
ctgggaaacagaaatcattttgttttagaaaggccatctgagactcatgcacactatctt
ttgagaactggacaggttgtagatttatcagacaccgtatacccaaggaaccctgtcatg
tgtagtgaagaagctagattaaagtcatttcacaactggccagactatgcccacttaacc
ccaagagagttagctcgtgctggactctactacacaggtattgatgatcaagtacagtgc
ttttgttgtggtgggaagttgaaaaattgggaaccttgtgatcgtgcgtggtcagaacac
aggcgacactttcctaattgcttctttgttttgggccggaatattaatatgcaaagtgaa
tcctctgtcgtgagttctgataggaatttcccaaattcaacaaatgctccaataaatcca
gccatggcagattacgaagcacggatcattacatttgggacgtggatgtactccgttaac
aaggagcagcttgcaagagctggattttatgctttaggtgaaggtgataaagtacagtgt
tttcactgtggaggagggctaaatgattggaaacccagtgaagacccttgggaacaacat
gctaagtggtttccaggctgtaaatatctgttagaagagaagggagaagaatatgtaaac
aatattcatttaacccattcaattgaggagtctctggggagaactgttgaaagagcacca
ttgttaactgaaataattgatgatacaatattccaaaatcctatggtacaagaagctata
cgaatgggattcagtttcaaggacattaagaaaacaatggaggggaaaattcagacatct
gggagcaactataaatcacttgaggttctggttgcagatctagtgaatgctcagaaagat
aatacacaagatgaatcaagtcagacttcattacagaaagacattagtactgaagagcag
ctaaggctcctacaagaggagaagctttgcaaaatctgtatggatagaaatattgctgtc
gtctttattccttgtggacatctggtcacttgtaaacagtgtgctgaagcagttgacaag
tgtcccatgtgctacacagccattactttgaggcaaaaaattttcatgtcgtaa

DBGET integrated database retrieval system