KEGG   Bos taurus (cow): 281684Help
Entry
281684            CDS       T01008                                 

Gene name
CHRM1
Definition
cholinergic receptor, muscarinic 1
Orthology
K04129  
muscarinic acetylcholine receptor M1
Organism
bta  Bos taurus (cow)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Cholinergic synapse
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:bta04020]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:bta04151]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:bta04080]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:bta04810]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:bta04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29
AA seq 460 aa AA seqDB search
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCALYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPETPPGRCCRCCRTPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPAKQPPRSSPNTVKRPTRKGRERAGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaatacctcagcgccacctgccgtcagccccaacatcaccgtcctggcaccgggaaag
ggtccctggcaagtggccttcatcgggatcaccacgggcctcctgtcactggccacagtg
acaggcaacctgctggtgctcatctctttcaaggtcaacacggagctcaagacggtcaac
aactacttcctgctgagcctggcctgtgccgacctcatcatcggtaccttctccatgaac
ctttacaccacgtatctgctcatgggccactgggctctgggcacgctggcctgcgacctc
tggctggccctggactatgtggccagcaacgcctcggtcatgaacctgctgctcatcagc
tttgaccgctacttctcggtgacccggcccctgagctaccgcgccaagcgcacaccccgc
cgggcagccctgatgatcggcctggcctggctggtttcgttcgtgctctgggccccggcc
atcctcttctggcagtacctggtaggggagcggacggtgctggccgggcagtgctacatc
cagttcctctcccagcccatcatcacctttggcacggccatggccgccttctacctcccc
gtcacggtcatgtgcgccctctactggcgcatctaccgggagacagagaaccgggcccgg
gagctggcggccctgcagggctcggagacgccggggaaggggggcggcagcagcagcagc
tcagagcggtcccagccgggggccgaaggctccccagagacccctccaggacgctgctgc
cgctgctgccggaccccccggctgctccaggcctacagctggaaggaggaagaggaggag
gacgaaggctccatggagtccctcacctcctcggagggtgaggagcctggctccgaggtg
gtgatcaagatgcccatggtggaccccgaggcgcaggcccccgccaagcagccgccccgg
agctccccgaatacggtcaagaggccgacccggaaggggcgcgagcgggcgggcaagggc
cagaagccccgtgggaaggagcaactggccaagcggaagaccttctcgctggtcaaggag
aagaaggcggctcggaccctgagcgctatcctgctggccttcatcctcacctggacgccg
tacaacatcatggtgctggtgtccaccttctgcaaggactgtgtccccgagaccctgtgg
gagctgggctactggctgtgctatgtcaacagcaccatcaaccccatgtgctacgcgctc
tgcaacaaggccttccgggacaccttccgcctgctgctgctctgccgctgggacaagcgt
cgctggcgcaagatccccaagcgccccggctctgtgcaccgcaccccctcccgccagtgc
tga

DBGET integrated database retrieval system