KEGG   Bos taurus (cow): 281713Help
Entry
281713            CDS       T01008                                 

Gene name
CREB1, CREB
Definition
cAMP responsive element binding protein 1
Orthology
K05870  
cyclic AMP-responsive element-binding protein 1
Organism
bta  Bos taurus (cow)
Pathway
cGMP-PKG signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
Osteoclast differentiation
Antigen processing and presentation
TNF signaling pathway
Circadian rhythm
Circadian entrainment
Cholinergic synapse
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Vasopressin-regulated water reabsorption
Huntington's disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Tuberculosis
Hepatitis B
HTLV-I infection
Viral carcinogenesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    281713 (CREB1)
   04022 cGMP - PKG signaling pathway
    281713 (CREB1)
   04151 PI3K-Akt signaling pathway
    281713 (CREB1)
   04152 AMPK signaling pathway
    281713 (CREB1)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    281713 (CREB1)
  Endocrine system
   04911 Insulin secretion
    281713 (CREB1)
   04915 Estrogen signaling pathway
    281713 (CREB1)
   04918 Thyroid hormone synthesis
    281713 (CREB1)
   04916 Melanogenesis
    281713 (CREB1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    281713 (CREB1)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    281713 (CREB1)
  Nervous system
   04725 Cholinergic synapse
    281713 (CREB1)
   04728 Dopaminergic synapse
    281713 (CREB1)
  Development
   04380 Osteoclast differentiation
    281713 (CREB1)
  Environmental adaptation
   04710 Circadian rhythm
    281713 (CREB1)
   04713 Circadian entrainment
    281713 (CREB1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    281713 (CREB1)
   05215 Prostate cancer
    281713 (CREB1)
  Neurodegenerative diseases
   05016 Huntington's disease
    281713 (CREB1)
  Substance dependence
   05030 Cocaine addiction
    281713 (CREB1)
   05031 Amphetamine addiction
    281713 (CREB1)
   05034 Alcoholism
    281713 (CREB1)
  Infectious diseases
   05152 Tuberculosis
    281713 (CREB1)
   05166 HTLV-I infection
    281713 (CREB1)
   05161 Hepatitis B
    281713 (CREB1)
Transcription factors [BR:bta03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    281713 (CREB1)
Mitochondrial biogenesis [BR:bta03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    281713 (CREB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
2
AA seq 325 aa AA seqDB search
MESGAENQQSGDAAVTEAESQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGT
KVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRK
ILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANN
GTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRT
APTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENRVA
VLENQNKTLIEELKALKDLYCHKSD
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggaatctggagcagagaaccagcagagtggagatgcagctgtaacagaagctgaaagc
cagcaaatgacagttcaagcccagccacagattgccacattagcccaggtatctatgcca
gcagctcacgcaacatcatctgctcccaccgtaactttagtacagctgcccaatgggacc
aaggttcaagtccatggagttattcaggcggcccagccatcagttattcagtctccacaa
gtccagacagttcagatttcaactattgcagaaagtgaagattcacaggagtcagtggat
agtgtaaccgattcccaaaaacgaagagagattctttcaaggaggccttcctacaggaaa
attttgaatgacttatcttctgatgcaccaggagtgccaaggattgaagaagagaaatct
gaagaggagacttcagcacctgccatcaccactgtcacggtgccaactccgatttatcag
actagcagtggacagtatattgccattacccaaggaggagcaatacaactggctaacaat
ggtactgatggggtacagggcctgcagacattaaccatgaccaatgcagctgccactcag
ccaggtactaccatcctgcagtatgcacagaccactgatggacagcaaatcctagtgccc
agcaaccaagttgttgttcaagctgcctctggagatgtacagacataccagattcgcaca
gcgcccactagcaccattgcccctggagttgttatggcgtcttccccagcacttcctaca
cagcctgctgaagaagcggcgcgaaagagagaggttcgcctcatgaagaacagggaagca
gcacgagagtgtcgtagaaagaagaaagaatatgtgaaatgtctagaaaacagagtggca
gtgcttgaaaatcaaaacaagacactgattgaggagctaaaagcacttaaggacctttac
tgccacaaatcagattaa

DBGET integrated database retrieval system