KEGG   Bos taurus (cow): 281741Help
Entry
281741            CDS       T01008                                 

Gene name
CYP21
Definition
cytochrome P450, subfamily XXI (steroid 21-hydroxylase) (EC:1.14.99.10)
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
bta  Bos taurus (cow)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    281741 (CYP21)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.10  steroid 21-monooxygenase
     281741 (CYP21)
Cytochrome P450 [BR:bta00199]
 Cytochrome P450, animal type
  CYP21 family
   281741 (CYP21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
23
AA seq 496 aa AA seqDB search
MVLAGLLLLLTLLAGAHLLWGRWKLRNLHLPPLVPGFLHLLQPNLPIHLLSLTQKLGPVY
RLRLGLQEVVVLNSKRTIEEAMIRKWVDFAGRPQIPSYKLVSQRCQDISLGDYSLLWKAH
KKLTRSALLLGTRSSMEPWVDQLTQEFCERMRVQAGAPVTIQKEFSLLTCSIICYLTFGN
KEDTLVHAFHDCVQDLMKTWDHWSIQILDMVPFLRFFPNPGLWRLKQAIENRDHMVEKQL
TRHKESMVAGQWRDMTDYMLQGVGRQRVEEGPGQLLEGHVHMSVVDLFIGGTETTASTLS
WAVAFLLHHPEIQRRLQEELDRELGPGASCSRVTYKDRARLPLLNATIAEVLRLRPVVPL
ALPHRTTRPSSIFGYDIPEGMVVIPNLQGAHLDETVWEQPHEFRPDRFLEPGANPSALAF
GCGARVCLGESLARLELFVVLLRLLQAFTLLPPPVGALPSLQPDPYCGVNLKVQPFQVRL
QPRGVEAGAWESASAQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggtcctcgcagggctgctgctgctgctcaccctgctagctggcgctcacctgctatgg
ggccggtggaagctcagaaacctccacctcccacctctggtccccggcttcctgcacctg
ctgcagcccaacctccccatccatctgctgagcctgactcagaaactcgggcctgtctac
aggcttcgccttgggctgcaagaggtggtggtgctgaactccaagaggaccattgaggag
gctatgatcaggaagtgggtggactttgccggcagaccccagataccatcctacaagctg
gtgtctcagcgctgccaggacatctctctgggggactactctctgctctggaaggcccac
aagaaactcacccgctcagccttgctgctgggcacccgcagctccatggagccctgggtg
gaccagctgacccaggagttctgcgagcgcatgagagtccaggccggtgcccccgtgacc
atccagaaggaattctctctgcttacctgcagcatcatctgttacctcacttttggaaac
aaggaggacaccttagtacatgcctttcacgactgtgttcaggacttgatgaagacctgg
gaccactggtccatccagattttggacatggttccttttctcaggttcttccccaaccct
gggctctggaggctgaagcaggccatagagaacagggaccacatggtggagaagcagctg
acgcgccacaaggagagcatggtggccggccagtggagggatatgacggactacatgctc
cagggggtagggaggcaaagagtagaagagggcccgggacagctcctggaaggacacgtg
cacatgtctgtggtggaccttttcatcgggggcactgaaaccacggcgagcaccctctcc
tgggctgtggcgttcctacttcaccaccccgagattcagcgccgccttcaggaggagttg
gatcgcgagctgggccccggagcctcatgctcccgagtcacttacaaggaccgcgctcgg
ctgcctctgctcaacgccaccatcgcggaggtgctgcgcctgcggccggtcgtgcccctg
gccttgcctcaccgcaccacgcggcctagcagcatcttcggctacgacatccctgagggc
atggtcgttatccccaacctccaaggtgcccacctggacgagaccgtctgggagcagccg
cacgagttccggccggaccgcttcctggagccgggcgcgaaccccagcgcgctggcattt
ggctgcggggcgcgcgtgtgcctgggcgagtcgctggcgcgcctggagctcttcgtggtg
ctcctgcgactgctgcaggccttcacgctgctgccgccgcccgtgggcgccctgccgtcg
ctgcagccggatccctactgcggtgtcaacctcaaggtccagcctttccaggtgcggctg
cagccccggggggtggaggccggggcctgggagagcgccagtgcccagtga

DBGET integrated database retrieval system