KEGG   Bos taurus (cow): 281741Help
Entry
281741            CDS       T01008                                 

Gene name
CYP21
Definition
(RefSeq) cytochrome P450, subfamily XXI (steroid 21-hydroxylase) (EC:1.14.14.16)
  KO
K00513  
steroid 21-monooxygenase [EC:1.14.14.16]
Organism
bta  Bos taurus (cow)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Aldosterone synthesis and secretion
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    281741 (CYP21)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    281741 (CYP21)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     281741 (CYP21)
Cytochrome P450 [BR:bta00199]
 Cytochrome P450, animal type
  CYP21 family
   281741 (CYP21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
23
AA seq 496 aa AA seqDB search
MVLAGLLLLLTLLAGAHLLWGRWKLRNLHLPPLVPGFLHLLQPNLPIHLLSLTQKLGPVY
RLRLGLQEVVVLNSKRTIEEAMIRKWVDFAGRPQIPSYKLVSQRCQDISLGDYSLLWKAH
KKLTRSALLLGTRSSMEPWVDQLTQEFCERMRVQAGAPVTIQKEFSLLTCSIICYLTFGN
KEDTLVHAFHDCVQDLMKTWDHWSIQILDMVPFLRFFPNPGLWRLKQAIENRDHMVEKQL
TRHKESMVAGQWRDMTDYMLQGVGRQRVEEGPGQLLEGHVHMSVVDLFIGGTETTASTLS
WAVAFLLHHPEIQRRLQEELDRELGPGASCSRVTYKDRARLPLLNATIAEVLRLRPVVPL
ALPHRTTRPSSIFGYDIPEGMVVIPNLQGAHLDETVWEQPHEFRPDRFLEPGANPSALAF
GCGARVCLGESLARLELFVVLLRLLQAFTLLPPPVGALPSLQPDPYCGVNLKVQPFQVRL
QPRGVEAGAWESASAQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggtcctcgcagggctgctgctgctgctcaccctgctagctggcgctcacctgctatgg
ggccggtggaagctcagaaacctccacctcccacctctggtccccggcttcctgcacctg
ctgcagcccaacctccccatccatctgctgagcctgactcagaaactcgggcctgtctac
aggcttcgccttgggctgcaagaggtggtggtgctgaactccaagaggaccattgaggag
gctatgatcaggaagtgggtggactttgccggcagaccccagataccatcctacaagctg
gtgtctcagcgctgccaggacatctctctgggggactactctctgctctggaaggcccac
aagaaactcacccgctcagccttgctgctgggcacccgcagctccatggagccctgggtg
gaccagctgacccaggagttctgcgagcgcatgagagtccaggccggtgcccccgtgacc
atccagaaggaattctctctgcttacctgcagcatcatctgttacctcacttttggaaac
aaggaggacaccttagtacatgcctttcacgactgtgttcaggacttgatgaagacctgg
gaccactggtccatccagattttggacatggttccttttctcaggttcttccccaaccct
gggctctggaggctgaagcaggccatagagaacagggaccacatggtggagaagcagctg
acgcgccacaaggagagcatggtggccggccagtggagggatatgacggactacatgctc
cagggggtagggaggcaaagagtagaagagggcccgggacagctcctggaaggacacgtg
cacatgtctgtggtggaccttttcatcgggggcactgaaaccacggcgagcaccctctcc
tgggctgtggcgttcctacttcaccaccccgagattcagcgccgccttcaggaggagttg
gatcgcgagctgggccccggagcctcatgctcccgagtcacttacaaggaccgcgctcgg
ctgcctctgctcaacgccaccatcgcggaggtgctgcgcctgcggccggtcgtgcccctg
gccttgcctcaccgcaccacgcggcctagcagcatcttcggctacgacatccctgagggc
atggtcgttatccccaacctccaaggtgcccacctggacgagaccgtctgggagcagccg
cacgagttccggccggaccgcttcctggagccgggcgcgaaccccagcgcgctggcattt
ggctgcggggcgcgcgtgtgcctgggcgagtcgctggcgcgcctggagctcttcgtggtg
ctcctgcgactgctgcaggccttcacgctgctgccgccgcccgtgggcgccctgccgtcg
ctgcagccggatccctactgcggtgtcaacctcaaggtccagcctttccaggtgcggctg
cagccccggggggtggaggccggggcctgggagagcgccagtgcccagtga

DBGET integrated database retrieval system