KEGG   Bos taurus (cow): 281741Help
Entry
281741            CDS       T01008                                 

Gene name
CYP21
Definition
cytochrome P450, subfamily XXI (steroid 21-hydroxylase) (EC:1.14.99.10)
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
bta  Bos taurus (cow)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:bta00140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
23
AA seq 496 aa AA seqDB search
MVLAGLLLLLTLLAGAHLLWGRWKLRNLHLPPLVPGFLHLLQPNLPIHLLSLTQKLGPVY
RLRLGLQEVVVLNSKRTIEEAMIRKWVDFAGRPQIPSYKLVSQRCQDISLGDYSLLWKAH
KKLTRSALLLGTRSSMEPWVDQLTQEFCERMRVQAGAPVTIQKEFSLLTCSIICYLTFGN
KEDTLVHAFHDCVQDLMKTWDHWSIQILDMVPFLRFFPNPGLWRLKQAIENRDHMVEKQL
TRHKESMVAGQWRDMTDYMLQGVGRQRVEEGPGQLLEGHVHMSVVDLFIGGTETTASTLS
WAVAFLLHHPEIQRRLQEELDRELGPGASCSRVTYKDRARLPLLNATIAEVLRLRPVVPL
ALPHRTTRPSSIFGYDIPEGMVVIPNLQGAHLDETVWEQPHEFRPDRFLEPGANPSALAF
GCGARVCLGESLARLELFVVLLRLLQAFTLLPPPVGALPSLQPDPYCGVNLKVQPFQVRL
QPRGVEAGAWESASAQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggtcctcgcagggctgctgctgctgctcaccctgctagctggcgctcacctgctatgg
ggccggtggaagctcagaaacctccacctcccacctctggtccccggcttcctgcacctg
ctgcagcccaacctccccatccatctgctgagcctgactcagaaactcgggcctgtctac
aggcttcgccttgggctgcaagaggtggtggtgctgaactccaagaggaccattgaggag
gctatgatcaggaagtgggtggactttgccggcagaccccagataccatcctacaagctg
gtgtctcagcgctgccaggacatctctctgggggactactctctgctctggaaggcccac
aagaaactcacccgctcagccttgctgctgggcacccgcagctccatggagccctgggtg
gaccagctgacccaggagttctgcgagcgcatgagagtccaggccggtgcccccgtgacc
atccagaaggaattctctctgcttacctgcagcatcatctgttacctcacttttggaaac
aaggaggacaccttagtacatgcctttcacgactgtgttcaggacttgatgaagacctgg
gaccactggtccatccagattttggacatggttccttttctcaggttcttccccaaccct
gggctctggaggctgaagcaggccatagagaacagggaccacatggtggagaagcagctg
acgcgccacaaggagagcatggtggccggccagtggagggatatgacggactacatgctc
cagggggtagggaggcaaagagtagaagagggcccgggacagctcctggaaggacacgtg
cacatgtctgtggtggaccttttcatcgggggcactgaaaccacggcgagcaccctctcc
tgggctgtggcgttcctacttcaccaccccgagattcagcgccgccttcaggaggagttg
gatcgcgagctgggccccggagcctcatgctcccgagtcacttacaaggaccgcgctcgg
ctgcctctgctcaacgccaccatcgcggaggtgctgcgcctgcggccggtcgtgcccctg
gccttgcctcaccgcaccacgcggcctagcagcatcttcggctacgacatccctgagggc
atggtcgttatccccaacctccaaggtgcccacctggacgagaccgtctgggagcagccg
cacgagttccggccggaccgcttcctggagccgggcgcgaaccccagcgcgctggcattt
ggctgcggggcgcgcgtgtgcctgggcgagtcgctggcgcgcctggagctcttcgtggtg
ctcctgcgactgctgcaggccttcacgctgctgccgccgcccgtgggcgccctgccgtcg
ctgcagccggatccctactgcggtgtcaacctcaaggtccagcctttccaggtgcggctg
cagccccggggggtggaggccggggcctgggagagcgccagtgcccagtga

DBGET integrated database retrieval system