KEGG   Bos taurus (cow): 281748Help
Entry
281748            CDS       T01008                                 

Gene name
ECHS1
Definition
enoyl CoA hydratase, short chain, 1, mitochondrial (EC:4.2.1.17)
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bta  Bos taurus (cow)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    281748 (ECHS1)
   01212 Fatty acid metabolism
    281748 (ECHS1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    281748 (ECHS1)
   00650 Butanoate metabolism
    281748 (ECHS1)
  Lipid metabolism
   00062 Fatty acid elongation
    281748 (ECHS1)
   00071 Fatty acid degradation
    281748 (ECHS1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    281748 (ECHS1)
   00310 Lysine degradation
    281748 (ECHS1)
   00380 Tryptophan metabolism
    281748 (ECHS1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    281748 (ECHS1)
Enzymes [BR:bta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     281748 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
26
AA seq 290 aa AA seqDB search
MAALRALLPRVRAPLRPWLFCPVQRSFASSAAFEYIITAKKGRNSNVGLIQLNRPKALNA
LCNGLIVELNQALQAFEEDPAVGAIVLTGGEKVFAAGADIKEMQSLTFQNCYSGGFLSHW
DQLTRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILIGTIPGAGGTQRLT
RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETVVEEAIQCAEKIASNSKIVTAMA
KESVNAAFEMTLAEGVKLEKKLFYSTFATEDRKEGMAAFVEKRKANFKDQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggccgccttacgtgccctgctgccccgcgtccgcgccccgctgcggccctggctcttc
tgcccggtgcagcgctccttcgcctcgagcgcagcctttgagtacatcatcacagcaaag
aagggaaggaacagcaacgtggggttgatccagctgaaccgccccaaggccctcaatgcg
ctctgcaacggcctgatcgtggagctcaaccaggcactgcaggccttcgaggaagaccca
gccgtgggggccattgtcctcacaggcggggagaaggtatttgcagctggagccgacatc
aaggaaatgcagagcctcacgttccagaactgttactctggcgggtttttgagccactgg
gaccagctcacacgtgtcaagaagccagtcatagctgctgtcaatggctatgcccttggt
ggtggctgtgaacttgctatgatgtgtgacatcatttatgctggagagaaagcccagttt
gggcagccggagattctaataggaaccatcccaggtgccggcggcacccagagactgacc
cgtgccgtcggaaagtcactggccatggagatggtcctcactggtgaccggatctcagcc
caggatgccaagcaagcaggtctcgtaagcaaaatttttcctgtcgagacagtggttgaa
gaagccatccaatgtgcagaaaaaattgccagcaactctaaaattgtaacagccatggcc
aaagaatcagtgaacgcagcttttgaaatgacattagctgagggcgttaaattggagaag
aagctcttctactcaacttttgccaccgaagaccggaaggaaggcatggccgcgtttgtg
gagaagagaaaggccaacttcaaagaccagtga

DBGET integrated database retrieval system