KEGG   Bos taurus (cow): 281748Help
Entry
281748            CDS       T01008                                 

Gene name
ECHS1
Definition
(RefSeq) enoyl-CoA hydratase, short chain 1
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bta  Bos taurus (cow)
Pathway
bta00062  Fatty acid elongation
bta00071  Fatty acid degradation
bta00280  Valine, leucine and isoleucine degradation
bta00310  Lysine degradation
bta00380  Tryptophan metabolism
bta00410  beta-Alanine metabolism
bta00640  Propanoate metabolism
bta00650  Butanoate metabolism
bta01100  Metabolic pathways
bta01200  Carbon metabolism
bta01212  Fatty acid metabolism
Module
bta_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
bta_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
bta_M00085  Fatty acid biosynthesis, elongation, mitochondria
bta_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    281748 (ECHS1)
   00650 Butanoate metabolism
    281748 (ECHS1)
  Lipid metabolism
   00062 Fatty acid elongation
    281748 (ECHS1)
   00071 Fatty acid degradation
    281748 (ECHS1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    281748 (ECHS1)
   00310 Lysine degradation
    281748 (ECHS1)
   00380 Tryptophan metabolism
    281748 (ECHS1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    281748 (ECHS1)
Enzymes [BR:bta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     281748 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 281748
NCBI-ProteinID: NP_001020377
BGD-bta: BT10980
Ensembl: ENSBTAG00000017710
UniProt: Q58DM8
Position
26
AA seq 290 aa AA seqDB search
MAALRALLPRVRAPLRPWLFCPVQRSFASSAAFEYIITAKKGRNSNVGLIQLNRPKALNA
LCNGLIVELNQALQAFEEDPAVGAIVLTGGEKVFAAGADIKEMQSLTFQNCYSGGFLSHW
DQLTRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILIGTIPGAGGTQRLT
RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETVVEEAIQCAEKIASNSKIVTAMA
KESVNAAFEMTLAEGVKLEKKLFYSTFATEDRKEGMAAFVEKRKANFKDQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggccgccttacgtgccctgctgccccgcgtccgcgccccgctgcggccctggctcttc
tgcccggtgcagcgctccttcgcctcgagcgcagcctttgagtacatcatcacagcaaag
aagggaaggaacagcaacgtggggttgatccagctgaaccgccccaaggccctcaatgcg
ctctgcaacggcctgatcgtggagctcaaccaggcactgcaggccttcgaggaagaccca
gccgtgggggccattgtcctcacaggcggggagaaggtatttgcagctggagccgacatc
aaggaaatgcagagcctcacgttccagaactgttactctggcgggtttttgagccactgg
gaccagctcacacgtgtcaagaagccagtcatagctgctgtcaatggctatgcccttggt
ggtggctgtgaacttgctatgatgtgtgacatcatttatgctggagagaaagcccagttt
gggcagccggagattctaataggaaccatcccaggtgccggcggcacccagagactgacc
cgtgccgtcggaaagtcactggccatggagatggtcctcactggtgaccggatctcagcc
caggatgccaagcaagcaggtctcgtaagcaaaatttttcctgtcgagacagtggttgaa
gaagccatccaatgtgcagaaaaaattgccagcaactctaaaattgtaacagccatggcc
aaagaatcagtgaacgcagcttttgaaatgacattagctgagggcgttaaattggagaag
aagctcttctactcaacttttgccaccgaagaccggaaggaaggcatggccgcgtttgtg
gagaagagaaaggccaacttcaaagaccagtga

DBGET integrated database retrieval system