KEGG   Bos taurus (cow): 281803Help
Entry
281803            CDS       T01008                                 

Gene name
PDIA3, GRP58
Definition
protein disulfide isomerase family A, member 3 (EC:5.3.4.1)
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
bta  Bos taurus (cow)
Pathway
Protein processing in endoplasmic reticulum
Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    281803 (PDIA3)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    281803 (PDIA3)
Enzymes [BR:bta01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     281803 (PDIA3)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   281803 (PDIA3)
  Exosomal proteins of colorectal cancer cells
   281803 (PDIA3)
  Exosomal proteins of bladder cancer cells
   281803 (PDIA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
21
AA seq 505 aa AA seqDB search
MRLRRLALFPGLALLLAAARLAAASDVLELTDDNFESRITDTGSSGLMLVEFFAPWCGHC
KKLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEESGAYDGPRT
ADGIVSHLKKQAGPASVPLKSEEEFEKFISDKDASVVGFFKDLFSEAHSEFLKAASNLRD
NYRFAHTNVESLVNKYDDDGEGITLFRPSHLTNKFEDKTVAYTEQKMTSGKIKRFIQENI
FGICPHMTEDNKDLLQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGKKLHFA
VASRKTFSHELSDFGLESTTGEIPVVAVRTAKGEKFVMQEEFSRDGKALERFLEDYFDGN
LKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELG
EKLRKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKQNPKKYEGGRELSDFISYL
KREATNPPVIQEEKPKKKKKAQEDL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctccgccgcctagcgctgttcccaggcctggcgctgctcctcgccgcggcccgc
ctcgctgctgcctccgatgtgctggaactcacggacgacaacttcgagagtcgcatcacc
gacacgggctcttctggcctcatgctcgtcgagttcttcgccccctggtgtggacactgc
aaaaagcttgccccagagtatgaagctgcagctaccagattaaaaggaatagtcccgtta
gcaaaggtggattgtactgccaacacgaacacctgtaataagtatggagtgagtggatat
ccaaccctgaagatatttagagatggtgaagaatcaggtgcctatgatgggcctaggact
gccgatggaattgtcagccacctgaagaaacaggctggaccagcttcagttcctctcaag
tctgaggaagaatttgaaaagttcattagcgataaagatgcttctgtggtgggttttttc
aaggatttattcagtgaagctcactctgagtttctaaaagcagccagcaacttgagggat
aactaccggtttgcacacaccaatgttgaatctctggtgaacaaatacgatgacgatgga
gagggtatcaccttgtttcgtccttcccatctgacgaacaagtttgaagacaagactgtg
gcatatacagaacagaaaatgaccagtgggaagattaaaagatttattcaggaaaacatt
tttggtatctgccctcacatgacagaagacaataaagatttactacagggcaaggattta
ctcatcgcttactatgatgtggactatgaaaagaatgctaaaggttccaactactggaga
aacagagtaatgatggtggcaaagaaattcctggatgctgggaagaaactccattttgct
gtagctagccgtaaaacctttagccatgaactttcagattttggcttggaaagcactact
ggagagattcctgttgttgctgtcagaaccgcaaaaggagagaagtttgtcatgcaggag
gagttctcgcgtgatggcaaggctcttgagagattcctggaggattactttgacggcaac
ctgaagagatacctgaagtctgagcctatccctgagagcaatgatgggcctgtaaaggta
gtggtagcagagaattttgatgaaatagtgaataatgaaaataaagatgtgctgattgag
ttttatgctccttggtgtggtcactgtaagaatctggagcctaagtataaagaactggga
gagaagctcagaaaagatccaaatattgtcatagccaagatggatgctacagccaacgat
gtgccttctccatatgaagtcagaggttttcctaccatctacttctctccagccaacaag
aagcaaaatccaaagaaatatgaaggtggccgtgaattaagtgattttattagctatcta
aagcgagaggctacaaacccccctgtaattcaagaagaaaaacccaagaagaagaagaag
gcacaggaggatctctaa

DBGET integrated database retrieval system