KEGG   Bos taurus (cow): 281810Help
Entry
281810            CDS       T01008                                 

Gene name
HADHA
Definition
hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
bta  Bos taurus (cow)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    281810 (HADHA)
   01212 Fatty acid metabolism
    281810 (HADHA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    281810 (HADHA)
   00650 Butanoate metabolism
    281810 (HADHA)
  Lipid metabolism
   00062 Fatty acid elongation
    281810 (HADHA)
   00071 Fatty acid degradation
    281810 (HADHA)
   01040 Biosynthesis of unsaturated fatty acids
    281810 (HADHA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    281810 (HADHA)
   00310 Lysine degradation
    281810 (HADHA)
   00380 Tryptophan metabolism
    281810 (HADHA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    281810 (HADHA)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     281810 (HADHA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     281810 (HADHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
11
AA seq 773 aa AA seqDB search
MRKMQKGLFYLIWVTDRNPIIFQKASLVLPLLRYICRSFTRSSALLTRTHINYGVRGDVA
VIRINSPNSKVNTLSQELHSEFMEVMNEVWSSSQIRSAVLISTKPGCFIAGADLNMLNSC
TTSQEVTQISQEAQKMFEKLEKSTKPVVAAINGSCLGGGLELAISCQYRIATKDKKTVLG
SPEVLLGILPGAGATQRLPKMVGRPAAFDMMLTGRGIRADRAKKMGLVDQLVEPLGPGVK
PPEERTIEYLEEVAITFAKGLADKKITPKRDKGLVEKLTSYALSIPFVRQQIYKKVEEKV
RKQTKGLYPAPLKIIDVVKTGIEQGSTAGYLSESQTFGELAMTKESKALMGLYRGQTQCK
KNKFGAPQKEVKQLAVVGAGLMGAGIAQVSVDKGLQTILKDTTLPALGRGQQQVFKGLND
KVKKKTLTSFERDAMFSNLIGQLDYRGFEKADMVIEAVFEDLNLKHRVLKEAEAVIPDHC
VFASNTSALPIGEIATVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDTTASAVDVGL
RQGKVIIVVKDGPGFYTTRCLTPMMSEVIRILQEGVGPKNLDSLTTSFGFPVGAATLVDE
GGVDVAKHVAENLGKMFGERFAGGSLEVLMQMISKGFLGRKSGKGFYIYQEGVKNKNLNS
DMDSILASLKMPSQPDVSSDEDIQYRLVTRFVNEAILCLQEGVLATPAEGDIGAVFGLGF
PPCLGGPFHFVDLYGAQKIVDRLRKYETAYEKQFTPCQLLVDHANNPNKKFYQ
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagatgcagaaagggctattctatttaatatgggtaacagatagaaatcccatc
atatttcagaaagcttccctggttctcccacttctcaggtatatttgccgcagttttaca
aggtcctctgctttgctgaccagaacccatattaactatggagtcagaggggatgtggca
gttattcgaattaactcacccaattcaaaggtgaatactctaagtcaagaactgcattca
gagttcatggaagtaatgaatgaagtctggtctagcagtcagatcagaagtgccgtcctt
atctcaacaaagcctggctgcttcattgcaggtgctgatctgaacatgttaaattcttgt
acgacctctcaagaagtaacgcaaatatcacaagaagcacagaaaatgtttgagaaactt
gagaagtccacaaagcctgtcgtggctgccatcaatggatcctgcttaggaggaggactt
gagcttgccatttcatgccaatacagaatagcaacaaaagataagaaaacagtattaggt
tcccctgaggtcttgctgggaatcttaccaggagcaggagccacacaaaggctgcccaag
atggtgggtagacctgctgcttttgacatgatgctgactggtagaggcattcgtgcagac
agagcaaagaaaatgggactggttgaccaactggtggaaccactgggaccaggagtaaaa
cctccagaggaacggacaattgaatacttagaagaagttgcaattacttttgccaaagga
ctagctgataaaaagatcactccaaagagagacaagggattggtagaaaaattgacgtca
tacgccttgagtattccatttgtcaggcaacagatttacaaaaaggtggaagaaaaagta
cgaaagcagaccaaaggcctttatcctgcacccctgaaaataattgatgtagtgaaaact
ggaatcgagcaagggagtactgctggctatctctctgaatctcagacatttggagagctt
gcaatgaccaaagaatcaaaagccttgatgggactttaccgtggtcaaacccaatgcaag
aagaataaatttggagcgccgcagaaggaggttaagcagcttgccgttgttggtgcaggg
ctgatgggagccggcattgctcaagtctccgtggataagggcctacagaccatacttaag
gacactacactgcccgcgctgggtcgaggacagcagcaggtgttcaaaggattgaatgat
aaagtgaagaagaaaacactaacatcatttgaaagggatgccatgttcagcaacttgatt
gggcagcttgattaccggggttttgaaaaggctgacatggtgattgaagccgtttttgag
gacctcaaccttaagcacagagtgctgaaggaggcagaagcggtgattccagatcactgt
gtctttgccagcaacacgtctgctcttccgatcggtgagattgctactgtcagtaaaaga
cctgagaaggtgatcggcatgcactacttctctcccgtggacaagatgcagctgctggag
attatcacaactgagaagacttcgaaggacacaactgcctctgctgtagatgttggcctc
agacaagggaaggtcatcattgtggttaaggatggacctggcttctataccaccaggtgc
ctcacacccatgatgtctgaagtcatcagaattctccaggaaggagttggccctaagaac
ctggactccctgaccacaagcttcggcttccctgtgggcgccgctacactggtagatgaa
ggtggtgtggatgtcgcaaaacacgtagcagaaaatctcggcaaaatgtttggggagcgg
tttgcaggtggaagcctggaagtgctgatgcagatgatatccaagggcttcctgggtcgc
aagtctgggaaaggcttttacatctaccaggagggtgtgaagaataagaatttgaattct
gacatggacagtattttggcaagtctgaagatgccttctcagcctgacgtctcctcagac
gaagacatccagtaccgcctagtgaccaggtttgtgaacgaagccatcctgtgcctgcag
gaaggggttttggccacgccagcagagggagacatcggtgcggtctttgggcttggcttc
cccccatgtcttggagggcccttccactttgtggatctgtacggggcacagaaaatagtg
gaccggctccggaagtacgagactgcctatgagaaacagttcaccccgtgtcagctgctt
gtggaccatgccaacaaccctaacaagaagttctaccaatga

DBGET integrated database retrieval system