KEGG   Bos taurus (cow): 281986Help
Entry
281986            CDS       T01008                                 

Gene name
PLCD1
Definition
(RefSeq) phospholipase C delta 1
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
bta  Bos taurus (cow)
Pathway
bta00562  Inositol phosphate metabolism
bta01100  Metabolic pathways
bta04020  Calcium signaling pathway
bta04070  Phosphatidylinositol signaling system
bta04919  Thyroid hormone signaling pathway
bta04933  AGE-RAGE signaling pathway in diabetic complications
Module
bta_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    281986 (PLCD1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    281986 (PLCD1)
   04070 Phosphatidylinositol signaling system
    281986 (PLCD1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    281986 (PLCD1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    281986 (PLCD1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     281986 (PLCD1)
Membrane trafficking [BR:bta04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    281986 (PLCD1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    281986 (PLCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 PH_12 PH EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5 SPARC_Ca_bdg TEP1_N
Motif
Other DBs
NCBI-GeneID: 281986
NCBI-ProteinID: NP_001075045
BGD-bta: BT10287
Ensembl: ENSBTAG00000037726
UniProt: P10895
Position
22
AA seq 756 aa AA seqDB search
MDSGRDFLTLHGLQDDKDLQALLKGGQLLKVKSNSWRRERFYKLQEDCKTIWQESRKVMR
TPESQLFSIEDIQEVRMGHRTEGLEKFARDVPENRCFSIVFKDQRNTLDLIAPSPADAQH
WVQGLGKIIHHSGSMDQQQKLRHWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSY
ARKIFKECDHSQTDSLEDEEIETFYKILTQRKEIDRTFEEATGSKETLSVDQLVTFLQHQ
QREEEAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFDLAHRRVYQDMDQ
PLSHYLVSSSHNTYLLEDQLTGPSSTEAYIRALCKGCRCLELDCWDGPNQEPIIYHGYTF
TSKILFCDVVRAIRDYAFKASPYPVILSLENHCSLEQQRVMARHLRTLLGPMLLDRPLDG
VVTSLPSPEQLRGKILLKGKKLGGLFPPGGEGGPEATVVSDEDEAAEMEDEAVRSQVQHK
SKEDKLRLAKELSDMVIYCKSVHFRGFPSSGTSGQAFYEMSSFSENRALRLLQESGNSFV
RHNVNHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGSEMDVYQGRFLDNGACG
YVLKPAFLRDPNSTFNSRALAHGPWWTPKRLNVRVISGQQLPKVNKNKNSIVDPKVTVEI
HGVSRDVASRQTAVVTNNGFNPWWDTELEFEVAVPELALVRFVVEDYDASSKNDFIGQST
IPLKSLKQGYRHIHLLSKNGDQHPSATLFVKVALQD
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggactcgggccgggacttcctgaccctgcacggcctacaggatgacaaggacctacag
gcactgctgaagggcggccaactcttgaaggtgaagtccaactcatggcggagagaacgc
ttctacaagctgcaggaggactgcaagaccatctggcaggagtcccgcaaggtcatgagg
accccggaatcccagctgttctccatcgaggacatccaggaggtgcggatggggcaccgc
acagagggcctggagaagtttgctcgggatgtgcctgagaatcgctgcttctccatagtc
ttcaaggaccagcgcaatactctagacctcattgccccatcaccagccgatgcccagcac
tgggtgcagggcctgggcaagatcatccaccactcgggctccatggaccagcagcagaag
ctgcgacactggattcattcctgcttgcgaaaagctgacaaaaacaaggacaacaagatg
agcttcaaagagctacaaaactttctgaaggagctcaacatccaggtggacgacagctat
gcccgaaagatcttcaaggaatgtgaccactctcagacagactccctggaggatgaggag
atagagaccttctacaagatactgacccagaggaaggagatcgaccgcaccttcgaggag
gccacgggctccaaggagaccctgtcggtggatcagttggtgaccttcttgcagcaccag
cagcgggaggaggaggcggggcctgcactggctctctccctcattgagcgctacgaaccc
agtgagacggccaaggcgcagcgtcagatgaccaaggacggctttcttatgtacctgctc
tcggctgacggcagcgccttcgacctggcgcaccggcgcgtctaccaggacatggaccag
ccgctcagccactacctggtgtcgtcctcgcacaacacctacctgctggaagaccagctc
acgggtcccagcagcacagaagcctacatccgggcgctgtgcaaaggctgccgctgcctg
gagctcgactgctgggatgggcccaaccaggagccgatcatctatcatggctacaccttc
acctccaagatcctcttctgcgacgtggtcagggccatccgggactacgccttcaaggca
tccccctaccccgtcatcctgtccttggagaaccactgcagcctggaacagcagcgtgtg
atggcgcgacacctgcgcaccctcctggggcccatgctgttggatcggccattggacggg
gtcgtcaccagcctgccttcccctgagcaactgagggggaagatcttgctgaaggggaag
aagcttggggggctcttcccgcctggaggagaaggtggcccagaggccactgtggtgtca
gacgaggatgaggctgctgagatggaggacgaggcggtgaggagccaagtgcagcacaag
tccaaggaggacaagctcaggctagcgaaggaactctccgacatggtcatttactgcaag
agtgtccactttcggggcttccccagctctggcacctctggacaggctttctatgagatg
tcatccttctctgagaaccgcgccctccgactgctccaagaatcaggaaacagctttgtc
cgccacaacgtgaatcacctgagcaggatctaccccgctgggtggagaacggactcttcc
aactacagccccgtggagatgtggaatgggggctgccagatcgtggccctgaacttccag
actcctgggtcagagatggatgtgtaccagggccgcttcctggacaatggggcctgtggg
tacgtgctgaagcctgccttcctgcgagaccccaactctaccttcaactcccgtgccctg
gcccacgggccctggtggactccgaaacgactcaatgtcagggtcatctcagggcagcag
ctgccaaaagtcaacaagaataagaattcaatcgtggaccccaaggtgacagtggagatc
catggcgtgagccgggacgtggccagccgccagaccgctgtggtcaccaataacggtttc
aatccgtggtgggacacagagttggagtttgaggtggctgtgcctgagcttgcccttgtg
cgctttgtggtggaggactacgatgcctcctccaagaacgacttcattggccagagcacc
atccccttgaaaagcctcaagcagggataccgacacatccacctcctctccaagaacggg
gaccagcacccgtctgccaccctctttgtgaaggtggccctccaggactag

DBGET integrated database retrieval system