KEGG   Bos taurus (cow): 282004Help
Entry
282004            CDS       T01008                                 

Gene name
PRKG1, CGKI, cGK_1, cGKI-beta
Definition
protein kinase, cGMP-dependent, type I (EC:2.7.11.12)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
bta  Bos taurus (cow)
Pathway
cGMP-PKG signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Module
cGMP signaling
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    282004 (PRKG1)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    282004 (PRKG1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    282004 (PRKG1)
  Digestive system
   04970 Salivary secretion
    282004 (PRKG1)
  Nervous system
   04730 Long-term depression
    282004 (PRKG1)
  Sensory system
   04740 Olfactory transduction
    282004 (PRKG1)
  Environmental adaptation
   04713 Circadian entrainment
    282004 (PRKG1)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     282004 (PRKG1)
Protein kinases [BR:bta01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   282004 (PRKG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
26
AA seq 671 aa AA seqDB search
MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMY
PVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTAT
VKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEET
HYENGEYIIRQGARGDTFFIISKGKVNVTREDSPNEDPVFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDF
NIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGI
IYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISAD
YWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPP
PDDNSGWDIDF
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagctggaggaagactttgccaagattctcatgctcaaggaggagaggatcaaa
gagctggagaagcggctgtcagagaaggaggaagaaatccaggagctgaagaggaaactc
cataaatgccagtcagtgctgcccgtgccctcgacccacatcggcccccggaccacccgg
gcacagggcatctcggccgagccgcagacctacaggtccttccacgacctccgacaggca
ttccggaagttcaccaaatccgaaaggtccaaggatctcataaaggaggccatccttgac
aatgactttatgaagaacttggagctgtcacagatccaagagattgtggattgtatgtac
ccagtggagtacggcaaagacagctgcatcatcaaagaaggagatgtggggtcactggtg
tatgtcatggaagatggtaaggttgaagttacaaaagaaggcgtgaagctgtgcacaatg
ggtcctggtaaagtgtttggagagttggctatcctttacaactgtacccggacggcgacc
gtcaaaactcttgtaaatgtgaaactctgggccattgatcgacaatgttttcagacgata
atgatgaggacaggacttatcaagcataccgagtatatggaatttttaaaaagcgttcca
acattccagagccttcctgaagagatcctcagtaagcttgctgacgtccttgaagagacc
cactatgaaaatggggaatatatcatcaggcaaggtgcaagaggggacaccttctttatc
atcagtaaaggaaaggttaatgtcactcgtgaagactcgcccaatgaagacccagtcttt
cttagaaccttaggaaaaggagattggtttggagagaaagccttgcagggggaagatgtg
agaacagcgaatgtaattgcggcagaagctgtaacctgccttgtgatcgacagagactct
ttcaaacatttgattggaggattagatgatgtttctaataaagcatatgaagatgcagaa
gctaaggcaaaatatgaagctgaagctgctttcttcgccaacctgaagctgtctgatttc
aacatcattgacacccttggagttggaggtttcggacgcgtagaactggtccagttaaaa
agtgaagaatccaaaacctttgcaatgaagattctcaagaaacggcacatcgtggataca
agacagcaggaacacatccgctcggagaagcagatcatgcagggggcccattcggacttc
atagtgagattatacagaacatttaaggacagcaaatatttgtatatgttgatggaagct
tgcctaggtggagagctctggaccattctcagggatcgggggtcatttgaagattctaca
accagattttatacagcatgtgtggtagaagcttttgcctatctgcattccaaaggaatc
atttacagggacctcaagcctgaaaatctcatcctagatcaccgaggttatgccaaactg
gttgattttggctttgcaaagaaaataggatttggaaagaaaacatggactttttgtggg
actccagaatatgtagccccagagatcatcctgaacaaaggccatgacatttcagccgac
tattggtcactgggaatcctcatgtatgagcttctgactggcagcccacctttctcaggc
ccagatcctatgaaaacctataacatcatattgagggggattgacatgatagagtttcca
aagaagattgccaaaaatgctgctaatttaattaaaaaactatgcagggataatccatca
gaaagattagggaatttgaaaaacggagtgaaagacattcaaaagcacaaatggtttgag
ggctttaattgggaaggcttaagaaaaggcaccttgacacctcctataataccaagtgtt
gcatcacccacagacacaagcaattttgacagtttccctgaggacaatgatgaaccgcca
cctgatgacaactcaggatgggacatagacttctaa

DBGET integrated database retrieval system