KEGG   Bos taurus (cow): 282004Help
Entry
282004            CDS       T01008                                 

Gene name
PRKG1, CGKI, cGK_1, cGKI-beta
Definition
protein kinase, cGMP-dependent, type I (EC:2.7.11.12)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
bta  Bos taurus (cow)
Pathway
Gap junction
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Class
Cellular Processes; Cell communication; Gap junction [PATH:bta04540]
Organismal Systems; Digestive system; Salivary secretion [PATH:bta04970]
Organismal Systems; Nervous system; Long-term depression [PATH:bta04730]
Organismal Systems; Sensory system; Olfactory transduction [PATH:bta04740]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:bta04713]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
UniProt: 
Structure
PDB: 

Jmol
Position
26
AA seq 671 aa AA seqDB search
MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMY
PVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTAT
VKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEET
HYENGEYIIRQGARGDTFFIISKGKVNVTREDSPNEDPVFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDF
NIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGI
IYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISAD
YWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPP
PDDNSGWDIDF
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagctggaggaagactttgccaagattctcatgctcaaggaggagaggatcaaa
gagctggagaagcggctgtcagagaaggaggaagaaatccaggagctgaagaggaaactc
cataaatgccagtcagtgctgcccgtgccctcgacccacatcggcccccggaccacccgg
gcacagggcatctcggccgagccgcagacctacaggtccttccacgacctccgacaggca
ttccggaagttcaccaaatccgaaaggtccaaggatctcataaaggaggccatccttgac
aatgactttatgaagaacttggagctgtcacagatccaagagattgtggattgtatgtac
ccagtggagtacggcaaagacagctgcatcatcaaagaaggagatgtggggtcactggtg
tatgtcatggaagatggtaaggttgaagttacaaaagaaggcgtgaagctgtgcacaatg
ggtcctggtaaagtgtttggagagttggctatcctttacaactgtacccggacggcgacc
gtcaaaactcttgtaaatgtgaaactctgggccattgatcgacaatgttttcagacgata
atgatgaggacaggacttatcaagcataccgagtatatggaatttttaaaaagcgttcca
acattccagagccttcctgaagagatcctcagtaagcttgctgacgtccttgaagagacc
cactatgaaaatggggaatatatcatcaggcaaggtgcaagaggggacaccttctttatc
atcagtaaaggaaaggttaatgtcactcgtgaagactcgcccaatgaagacccagtcttt
cttagaaccttaggaaaaggagattggtttggagagaaagccttgcagggggaagatgtg
agaacagcgaatgtaattgcggcagaagctgtaacctgccttgtgatcgacagagactct
ttcaaacatttgattggaggattagatgatgtttctaataaagcatatgaagatgcagaa
gctaaggcaaaatatgaagctgaagctgctttcttcgccaacctgaagctgtctgatttc
aacatcattgacacccttggagttggaggtttcggacgcgtagaactggtccagttaaaa
agtgaagaatccaaaacctttgcaatgaagattctcaagaaacggcacatcgtggataca
agacagcaggaacacatccgctcggagaagcagatcatgcagggggcccattcggacttc
atagtgagattatacagaacatttaaggacagcaaatatttgtatatgttgatggaagct
tgcctaggtggagagctctggaccattctcagggatcgggggtcatttgaagattctaca
accagattttatacagcatgtgtggtagaagcttttgcctatctgcattccaaaggaatc
atttacagggacctcaagcctgaaaatctcatcctagatcaccgaggttatgccaaactg
gttgattttggctttgcaaagaaaataggatttggaaagaaaacatggactttttgtggg
actccagaatatgtagccccagagatcatcctgaacaaaggccatgacatttcagccgac
tattggtcactgggaatcctcatgtatgagcttctgactggcagcccacctttctcaggc
ccagatcctatgaaaacctataacatcatattgagggggattgacatgatagagtttcca
aagaagattgccaaaaatgctgctaatttaattaaaaaactatgcagggataatccatca
gaaagattagggaatttgaaaaacggagtgaaagacattcaaaagcacaaatggtttgag
ggctttaattgggaaggcttaagaaaaggcaccttgacacctcctataataccaagtgtt
gcatcacccacagacacaagcaattttgacagtttccctgaggacaatgatgaaccgcca
cctgatgacaactcaggatgggacatagacttctaa

DBGET integrated database retrieval system