KEGG   Bos taurus (cow): 282091Help
Entry
282091            CDS       T01008                                 

Gene name
PPP1R16B, TIMAP
Definition
protein phosphatase 1, regulatory subunit 16B
Orthology
K17459  
protein phosphatase 1 regulatory inhibitor subunit 16B
Organism
bta  Bos taurus (cow)
Brite
Protein phosphatases and associated proteins [BR:bta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     282091 (PPP1R16B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
13
AA seq 568 aa AA seqDB search
MASHVDLLTELQLLEKVPTLERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGR
RKKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLL
LSHGANVNAKDNELWTPLHAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTL
DVIETCMAYQGITQEKINEMRAAPEQQMISDIHCMIAAGQDLDWVDAQGATLLHIAGANG
YLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMQMAELLVSHGASLSARTSMDEMPID
LCEEEEFKVLLLELKHKHDVIMKSQLRHKSSLSRRTSSAGSRGKVVRRASLSDRTNLYRK
EYEGEAILWQQRSASEDQRNSTYNGDIRETRTDQENKDPNPRLEKPVLLSEFPTKIPHSD
MDMPVENGLRAPVSTYQYALCNGDVWKVHEVPDYSMAYGNPGVADATPSWSGYKEQSPQT
LLELKRQRAAAKLLSHPFLSTHLGSGVSRTGEGSSEGKAPLIGGRTSPYSSNGTSVYYTV
TSGDPPLLKFKAPIEEMEEKVHGCCRIS
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggccagccacgtggacctgctgaccgaactgcagctgctggagaaggtgcccacgttg
gagcggctgcgcgcagcccagaagcgccgggcccagcagctgaagaagtgggcgcagtat
gagcaggacctgcagcatcgcaagcgcaagcatgagcggaagcgcagcacgggcggccgg
cgaaagaaggtgtccttcgaggccagtgtggccctcctggaggcctcgcttaggaacgac
gctgaagaagtgcgctacttcctgaagaataaggtcagccctgatttgtgcaacgaagat
ggactcaccgccctgcaccagtgctgcatcgacaactttgaggaaattgtcaagctgctc
ctttcgcacggtgccaacgtgaacgccaaggacaacgagctgtggacgcccctgcacgcc
gcggccacctgcggccacattaacctggtgaaaatcctcgttcagtatggagccgacttg
ctcgctgtcaactccgatgggaacatgccctatgacctctgtgaggatgagcccaccctg
gatgttatcgagacgtgcatggcgtaccagggcatcacccaggagaaaatcaacgagatg
cgggcagctcccgagcagcagatgatttcagacattcattgtatgatcgcagctggccag
gaccttgactgggtggatgcccagggggccacactgctgcacatagctggagccaacgga
tacctgcgggcagccgagctcctcctggatcatggtgtacgcgtggatgtgaaggactgg
gatggctgggagcccctgcacgccgctgccttctggggacagatgcagatggcagagctg
ttggtgtcccatggggccagtctcagtgctaggacgtccatggacgagatgccaattgac
ctgtgtgaagaggaggagttcaaagtcctgctgttggagctgaaacacaagcacgacgtg
atcatgaagtcgcagctgaggcataagtcatctttgagcaggaggacgtccagcgcgggc
agccgagggaaggtggtacgtcgagccagcctgtccgacaggaccaacctgtacaggaag
gagtatgagggagaggctatactctggcagcagcggagtgcatccgaggatcagcggaac
tccacctacaacggggacatcagggagaccaggacagaccaagagaataaggacccgaac
cccaggctggagaagcccgtgctgctctccgagtttcccaccaagatcccacacagcgac
atggacatgcctgttgagaacggcctccgggctccagtcagcacctaccagtatgcgctg
tgtaacggggacgtctggaaagtgcacgaggtgcccgactacagcatggcctatggcaac
cctggcgtggccgatgccaccccatcctggagtggctacaaggaacagagcccccagacg
cttctggagctgaagaggcagcgggctgcggccaagctgctcagccaccccttcctgagc
acccacctgggcagtggcgtgtccaggacgggcgagggcagcagcgaaggcaaggccccc
ttgatcggaggcagaacttctccgtacagtagcaatgggacctcggtgtattacacggtc
accagtggagaccccccactcctgaagttcaaggcccccatagaggagatggaggagaag
gtccatggctgctgccgcatctcctag

DBGET integrated database retrieval system