KEGG   Bos taurus (cow): 282134Help
Entry
282134            CDS       T01008                                 

Gene name
ADRA1A
Definition
(RefSeq) adrenoceptor alpha 1A
  KO
K04135  adrenergic receptor alpha-1A
Organism
bta  Bos taurus (cow)
Pathway
bta04020  Calcium signaling pathway
bta04022  cGMP-PKG signaling pathway
bta04080  Neuroactive ligand-receptor interaction
bta04152  AMPK signaling pathway
bta04261  Adrenergic signaling in cardiomyocytes
bta04270  Vascular smooth muscle contraction
bta04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    282134 (ADRA1A)
   04022 cGMP - PKG signaling pathway
    282134 (ADRA1A)
   04152 AMPK signaling pathway
    282134 (ADRA1A)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    282134 (ADRA1A)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    282134 (ADRA1A)
   04270 Vascular smooth muscle contraction
    282134 (ADRA1A)
  Digestive system
   04970 Salivary secretion
    282134 (ADRA1A)
G protein-coupled receptors [BR:bta04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    282134 (ADRA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 282134
NCBI-ProteinID: NP_776923
BGD-bta: BT22464
UniProt: P18130
Position
8
AA seq 466 aa AA seqDB search
MVFLSGNASDSSNCTHPPPPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNVWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQKRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
AQVGGSGVTSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FRPSETVFKIAFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRKQSSKHTLGYTL
HAPSHVLEGQHKDLVRIPVGSAETFYKISKTDGVCEWKIFSSLPRGSARMAVARDPSACT
TARVRSKSFLQVCCCLGPSTPSHGENHQIPTIKIHTISLSENGEEV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttctctccggaaatgcctccgacagctccaactgcacccacccgccgccaccg
gtgaacatttccaaggccattctgctcggggtgatcttggggggcctcatccttttcggg
gtactggggaacatcctcgtgatcctttccgtggcctgccaccggcacctgcactcggtc
acacactactacatcgtcaacctggcggtggccgaccttctcctcacttccacggtgctg
cccttctccgctatcttcgagatcttgggctactgggccttcggcagggtcttctgcaat
gtctgggcggcggtggacgtcctgtgctgcacggcttccatcatgggactctgcatcatc
tccatcgaccgctacatcggcgtgagctatcctctgcgctaccccaccatcgtcacccag
aagaggggcctcatggccctgctctgcgtctgggcgctctctttggtcatctccatcggg
cccctcttcggctggaggcagccggccccggaggacgagaccatctgccagatcaacgag
gagccgggctacgtgctcttctcggctctgggctccttctacgtgccgctgaccatcatc
ctggtcatgtactgccgggtctacgtcgtggccaagagggagagccggggcctcaagtcg
ggccttaagaccgacaagtcagactcggagcaggtgacgctccgcatccatcgcaaaaac
gcccaggtaggaggcagcggggtgaccagcgccaagaacaagacgcacttctccgtgaga
ctgctcaaattttcccgcgagaagaaagcggccaaaacgctgggcatcgtggtcggctgc
ttcgtcctctgctggctgccttttttcttagtgatgcccattgggtctttctttcctgat
ttcaggccctcagaaaccgtttttaaaatagcattttggctcggttacctaaacagctgc
atcaaccccattatatacccatgctccagtcaagagtttaaaaaggcctttcagaatgtc
ttgagaatccagtgtctgcgacgaaagcagtcctccaaacacaccctgggctacacgctg
cacgcacccagccacgtcctggagggacagcacaaggacctggttcgcattccggtggga
tctgcagagaccttctataagatctccaagacggatggggtctgtgaatggaaaattttc
tcttccctaccccgcggatctgccaggatggcggtggccagagacccatcagcctgcacc
actgcccgggtgagaagtaaaagctttttgcaagtgtgctgttgcctggggccctcgacc
cccagtcatggagagaatcatcagattccgaccattaagatccacaccatctccctcagt
gaaaatggggaggaagtctaa

DBGET integrated database retrieval system