KEGG   Bos taurus (cow): 282141Help
Entry
282141            CDS       T01008                                 

Gene name
ANGPT2
Definition
angiopoietin 2
Orthology
K05466  
angiopoietin 2
Organism
bta  Bos taurus (cow)
Pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:bta04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:bta04015]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:bta04066]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:bta04151]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
27
AA seq 496 aa AA seqDB search
MWQLVFLTLSCDLAVATAHSGSRKGMDIAAGKKQYQVQHGACSYTFLLPETDHCRSPSSA
YVPNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQN
QTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTS
EISKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATV
NNSVLQKQQHDLMETVNNLLTLMSTSNPSYSLLAKDEQIIFRDCGEAFKSGLTTSGVYTL
TFPNSTEEIKAYCDMETGGGGWTVIQRREDGSVDFQRTWKEYKVGFGNPSGEHWLGNEFV
SQVTGQKRYVLKIHLRDWEGNEAYSLYDHFYLSNEELNYRIHLKGLTGTAGKISSISQPG
NDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGS
GYSLKATTMMIRPADF
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagcttgttttcttgactctgagctgtgatctggccgtagccacagcccacagc
ggctctcggaagggcatggacatcgccgctgggaagaaacagtatcaggttcagcacgga
gcctgtagctacacgttcctcctgccggagacggaccactgccgctcgccctccagcgcc
tacgtgcctaacgccgtgcagagggacgcgccccttgactacgacgactcggtgcagagg
ctgcaggtgctggagaacatcatggagaacaacacacagtggctcatgaagcttgagaat
tacatccaggacaacatgaagaaagagatggtggagatacaacagaatgcagtgcagaac
cagaccgctgtgatgatagaaatagggaccaacctgctcaatcaaaccgcagagcagacc
cggaagttaaccgatgttgaagcccaagtattaaatcagacaacaagacttgaacttcag
cttctagaacactctctttctacaaacaaattggaaaaacagattttggatcagaccagt
gaaataagcaaactgcaagataagaacagtttcctggaaaagaaagttctagatatggaa
gacaagcacatagttcaacttcggtcaatcaaagaagagaaagatcagctccaggtgtta
gtatccaagcaaaattccatcattgaagaactggaaaaacaactggtgacggccacggtg
aataattcagttctccaaaagcagcaacatgatctgatggagacagttaataatttactg
actctgatgtcaacatcaaacccctcatactccttgcttgccaaggacgaacaaatcatc
ttcagagactgcggggaggcattcaaatcgggactgaccaccagcggtgtctacacattg
acgttccctaactccacggaggagatcaaggcttactgtgacatggaaacgggtggaggt
gggtggacagttattcagcgacgtgaagacggcagtgttgattttcagaggacttggaaa
gaatataaagtgggattcgggaacccttcaggtgaacactggctgggaaatgagtttgtt
tcgcaggtgacgggtcagaaacgctacgtgctgaaaatacacctaagagactgggaaggg
aatgaggcttactcgctgtacgaccacttctatctctcgaatgaagaactcaactacagg
attcaccttaaaggcctcacggggacagccggcaaaataagcagcataagccagccagga
aatgattttagcacgaaggatgcagacaacgacaaatgcatttgcaaatgctcacaaatg
ctcacaggaggctggtggtttgatgcctgtggtccttccaacctgaatggaatgtactac
ccacagaggcagaacacaaataagttcaacggtattaagtggtactactggaagggctcc
ggctactcacttaaggccacgaccatgatgatccgtccagcagatttctaa

DBGET integrated database retrieval system