KEGG   Bos taurus (cow): 282152Help
Entry
282152            CDS       T01008                                 

Gene name
BCL2L1, BCLX, Bcl-xL
Definition
(RefSeq) BCL2 like 1
  KO
K04570  
Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
bta  Bos taurus (cow)
Pathway
EGFR tyrosine kinase inhibitor resistance
Platinum drug resistance
Ras signaling pathway
NF-kappa B signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Apoptosis - multiple species
NOD-like receptor signaling pathway
Jak-STAT signaling pathway
Amyotrophic lateral sclerosis (ALS)
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Pancreatic cancer
Chronic myeloid leukemia
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    282152 (BCL2L1)
   04630 Jak-STAT signaling pathway
    282152 (BCL2L1)
   04064 NF-kappa B signaling pathway
    282152 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    282152 (BCL2L1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    282152 (BCL2L1)
   04215 Apoptosis - multiple species
    282152 (BCL2L1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    282152 (BCL2L1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    282152 (BCL2L1)
   05202 Transcriptional misregulation in cancers
    282152 (BCL2L1)
   05212 Pancreatic cancer
    282152 (BCL2L1)
   05220 Chronic myeloid leukemia
    282152 (BCL2L1)
   05222 Small cell lung cancer
    282152 (BCL2L1)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    282152 (BCL2L1)
  Infectious diseases
   05166 HTLV-I infection
    282152 (BCL2L1)
   05145 Toxoplasmosis
    282152 (BCL2L1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    282152 (BCL2L1)
   01524 Platinum drug resistance
    282152 (BCL2L1)
Protein phosphatases and associated proteins [BR:bta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     282152 (BCL2L1)
Chromosome [BR:bta03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    282152 (BCL2L1)
Transporters [BR:bta02000]
 Other Transporters
  Pores ion channels [TC:1]
   282152 (BCL2L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
13
AA seq 233 aa AA seqDB search
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHLA
DSPAVNGATGHSRSSDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagagtaaccgggagctggtggttgactttctctcttacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg
acagaatcagatatggaaacccccagtgccatcaatggcaacgcatcctggcacctggcg
gatagccctgctgtgaatggagccactggccacagcagaagctcggatgcccgggaagtg
atccccatggcagcggtgaagcaagccctgagggaggcaggcgatgagtttgaactgagg
taccgacgggcattcagcgacctgacgtcccagctccacatcaccccagggacagcatat
cagagctttgaacaggtagtgaatgaactcttccgggacggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcaacttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgcagca
gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg
gctggtgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system