KEGG   Bos taurus (cow): 282152Help
Entry
282152            CDS       T01008                                 

Gene name
BCL2L1, BCLX, Bcl-xL
Definition
BCL2-like 1
Orthology
K04570  
BCL2-like 1 (apoptosis regulator Bcl-X)
Organism
bta  Bos taurus (cow)
Pathway
Ras signaling pathway
NF-kappa B signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Jak-STAT signaling pathway
Amyotrophic lateral sclerosis (ALS)
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Pancreatic cancer
Chronic myeloid leukemia
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:bta04014]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:bta04630]
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:bta04064]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:bta04151]
Cellular Processes; Cell growth and death; Apoptosis [PATH:bta04210]
Human Diseases; Cancers; Pathways in cancer [PATH:bta05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:bta05202]
Human Diseases; Cancers; Pancreatic cancer [PATH:bta05212]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:bta05220]
Human Diseases; Cancers; Small cell lung cancer [PATH:bta05222]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:bta05014]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:bta05166]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:bta05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
13
AA seq 233 aa AA seqDB search
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHLA
DSPAVNGATGHSRSSDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagagtaaccgggagctggtggttgactttctctcttacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg
acagaatcagatatggaaacccccagtgccatcaatggcaacgcatcctggcacctggcg
gatagccctgctgtgaatggagccactggccacagcagaagctcggatgcccgggaagtg
atccccatggcagcggtgaagcaagccctgagggaggcaggcgatgagtttgaactgagg
taccgacgggcattcagcgacctgacgtcccagctccacatcaccccagggacagcatat
cagagctttgaacaggtagtgaatgaactcttccgggacggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcaacttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgcagca
gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg
gctggtgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system