KEGG   Bos taurus (cow): 282187Help
Entry
282187            CDS       T01008                                 

Gene name
COL1A1
Definition
collagen, type I, alpha 1
Orthology
K06236  
collagen, type I/II/III/V/XI/XXIV/XXVII, alpha
Organism
bta  Bos taurus (cow)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Platelet activation
Protein digestion and absorption
Amoebiasis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    282187 (COL1A1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    282187 (COL1A1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    282187 (COL1A1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    282187 (COL1A1)
  Digestive system
   04974 Protein digestion and absorption
    282187 (COL1A1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    282187 (COL1A1)
Heparan sulfate/heparin binding proteins [BR:bta00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  282187 (COL1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
19
AA seq 1463 aa AA seqDB search
MFSFVDLRLLLLLAATALLTHGQEEGQEEGQEEDIPPVTCVQNGLRYHDRDVWKPVPCQI
CVCDNGNVLCDDVICDELKDCPNAKVPTDECCPVCPEGQESPTDQETTGVEGPKGDTGPR
GPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPQLSYGYDEKSTGISVPGPM
GPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRP
GERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQM
GPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEGGPQGPR
GSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQ
GPSGPPGPKGNSGEPGAPGSKGDTGAKGEPGPTGIQGPPGPAGEEGKRGARGEPGPAGLP
GPPGERGGPGSRGFPGADGVAGPKGPAGERGAPGPAGPKGSPGEAGRPGEAGLPGAKGLT
GSPGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGVP
GPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQ
GVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAGAPGAPGSQ
GAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGAPGKDGVRGLTGPIGPPGPAGAPGDK
GEAGPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGPP
GPAGPAGPPGPIGNVGAPGPKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPA
GKEGSKGPRGETGPAGRPGEVGPPGPPGPAGEKGAPGADGPAGAPGTPGPQGIAGQRGVV
GLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGAPGAE
GSPGRDGSPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGETGPAGPAGPIGPV
GARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPR
GPPGSAGSPGKDGLNGLPGPIGPPGPRGRTGDAGPAGPPGPPGPPGPPGPPSGGYDLSFL
PQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRD
LKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKEK
RHVWYGESMTGGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQT
GNLKKALLLQGSNEIEIRAEGNSRFTYSVTYDGCTSHTGAWGKTVIEYKTTKTSRLPIID
VAPLDVGAPDQEFGFDVGPACFL
NT seq 4392 nt NT seq  +upstreamnt  +downstreamnt
atgttcagctttgtggacctccggctcctgctcctcttagcggccaccgccctcctgacg
cacggccaagaggagggccaggaagaaggccaagaagaagacatcccaccagtcacctgc
gtacagaacggcctcaggtaccatgaccgagacgtgtggaaacccgtgccctgccagatc
tgtgtctgcgacaacggcaacgtgctgtgcgatgacgtgatctgcgacgaacttaaggac
tgtcctaacgccaaagtccccacggacgaatgctgccccgtctgccccgaaggccaggaa
tcacccacggaccaagaaaccaccggagtcgagggaccgaaaggagacactggcccccga
ggcccaaggggacccgccggcccccccggccgagatggcatccctggacaacctggactt
cccggaccccctggaccccccggacctcccggaccccctggcctcggaggaaactttgct
ccccagttgtcttacggctatgatgagaaatcaacaggaatttccgtgcctggtcccatg
ggtccttctggtcctcgtggtctccctggcccccctggcgcacctggtccccaaggtttc
caaggcccccctggtgagcctggcgagccaggagcctcaggtcccatgggtccccgtggt
ccccctggcccccctggcaagaacggagatgatggcgaagctggaaagcctggtcgtcct
ggtgagcgcgggcctcccggacctcagggtgctcggggattgcctggaacagctggcctc
cctggaatgaagggacacagaggtttcagtggtttggatggtgccaagggagatgctggt
cctgctggccccaagggcgagcctggtagccccggtgaaaatggagctcctggtcagatg
ggcccccgtggtctgcctggtgagagaggtcgccctggagcccctggccctgctggtgct
cgaggaaatgatggtgcgactggtgctgctgggccccctggtcccactggccccgctggt
cctcctggtttccctggtgctgtgggtgctaagggtgaaggtggtccccaaggaccccga
ggttctgaaggtccccagggtgtacgtggtgagcctggcccccctggccctgctggtgct
gctggccctgctggcaaccctggtgctgatggacagcctggtgctaaaggagccaatggc
gctcctggtattgctggtgctcctggcttccctggtgcccgaggcccctctggaccccag
ggccccagcggcccccctggccccaagggtaacagcggtgaacctggtgctcctggcagc
aaaggagacactggcgccaagggagaacccggtcccactggtattcaaggcccccctggc
cccgctggggaagaaggaaagcgaggagcccgaggtgaacctggacctgctggcctgcct
ggaccccctggcgagcgtggtggacctggaagccgtggtttccctggcgccgacggtgtt
gctggtcccaagggtcctgctggtgaacgcggtgctcctggccctgctggccccaaaggt
tctcctggtgaagctggtcgccccggtgaagctggtctgcccggtgccaagggtctgact
ggaagccctggcagcccgggtcctgatggcaaaactggcccccctggtcccgccggtcaa
gatggccgccctggacctccaggccctcccggtgcccgtggtcaggctggcgtgatgggt
ttccctggacctaaaggtgctgctggagagcctggaaaagctggagagcgaggtgttcct
ggaccccctggcgctgttggtcctgctggcaaagacggagaagctggagctcagggaccc
ccaggacctgctggccccgctggtgagagaggcgaacaaggccctgctggctcccctgga
ttccagggtctccccggccctgctggtcctcctggtgaagcaggcaaacctggtgaacag
ggtgttcctggagatcttggtgcccccggcccctctggagcaagaggcgagagaggtttc
cccggcgagcgtggtgtgcaagggccgcccggtcctgcaggtccccgtggggccaatggt
gcccctggcaacgatggtgctaagggtgatgctggtgcccctggagcccccggtagccag
ggtgcccctggccttcaaggaatgcctggtgaacgaggtgcagctggtcttccaggccct
aagggtgacagaggggatgctggtcccaaaggtgctgatggtgctcctggcaaagatggc
gtccgtggtctgactggtcccatcggtcctcctggccccgctggtgcccctggtgacaag
ggtgaagctggtcctagtggcccagccggtcccactggagctcgtggtgcccccggtgac
cgtggtgagcctggtccccccggccctgctggcttcgctggcccccctggtgctgatggc
caacctggtgctaaaggcgaacctggtgatgctggtgctaaaggtgacgctggtcccccc
ggccctgctgggcccgctggaccccccggccccattggtaacgttggtgctcccggaccc
aaaggtgctcgtggcagcgctggtccccctggtgctactggtttcccaggtgctgctggc
cgagtcggtccccccggcccctctggaaatgctggaccccctggccctcctggccctgct
ggcaaagaaggcagcaaaggcccccgcggtgagactggccccgctgggcgtcccggtgaa
gtcggtccccctggtccccctggccccgctggtgagaaaggagcccctggtgctgacgga
cctgctggagctcctggcactcctggacctcaaggtattgctggacagcgtggtgtggtc
ggcctgcctggtcagagaggagaaagaggcttccctggtcttcctggcccctctggtgaa
cccggcaaacaaggtccttctggagcaagtggtgaacgtggcccccctggtcccatgggc
ccccctggattggctggaccccctggcgagtctggacgtgagggagctcctggtgctgaa
ggatcccctggacgagatggttctcctggcgccaagggtgaccgtggtgagaccggccct
gctggacctcctggtgctcctggcgctcccggtgcccccggccctgtcggacctgccggc
aagagcggtgatcgtggtgagaccggtcctgctggtcctgctggtcccattggccccgtt
ggtgcccgtggccccgctggaccccaaggcccccgtggtgacaagggtgagacaggcgaa
cagggcgacagaggcattaagggtcaccgtggcttctctggtctccagggtccccccggc
cctcccggctctcctggtgagcaaggtccttccggagcctctggtcctgctggtccccgc
ggtccccctggctctgctggttctcccggcaaagatggactcaatggtctcccaggcccc
atcggtccccctgggcctcgaggtcgcactggtgatgctggtcctgctggtcctcccggc
cctcctggaccccctggtcccccaggtcctcccagcggcggctacgacttgagcttcctg
ccccagccacctcaagagaaggctcacgatggtggccgctactaccgggctgatgatgcc
aatgtggtccgtgaccgtgacctcgaggtggacaccaccctcaagagcctgagccagcag
atcgagaacatccggagccctgaaggcagccgcaagaaccccgcccgcacctgccgtgac
ctcaagatgtgccactctgactggaagagcggagaatactggattgaccccaaccaaggc
tgcaacctggatgccattaaggtcttctgcaacatggaaaccggtgagacctgtgtatac
cccactcagcccagcgtggcccagaagaactggtatatcagcaagaaccccaaggaaaag
aggcacgtctggtacggcgagagcatgaccggcggattccagttcgagtatggcggccag
gggtccgatcctgccgatgtggccatccagctgactttcctgcgcctgatgtccaccgag
gcctcccagaacatcacctaccactgcaagaacagcgtggcctacatggaccagcagact
ggcaacctcaagaaggccctgctcctccagggctccaacgagatcgagatccgggccgag
ggcaacagccgcttcacctacagcgtcacctacgatggctgcacgagtcacaccggagcc
tggggcaagacagtgatcgaatacaaaaccaccaagacctcccgcttgcccatcatcgat
gtggcccccttggacgttggcgccccagaccaggaattcggcttcgacgttggccctgcc
tgcttcctgtaa

DBGET integrated database retrieval system