KEGG   Bos taurus (cow): 282211Help
Entry
282211            CDS       T01008                                 

Gene name
CYP2D14, CYP2D6
Definition
cytochrome P450, family 2, subfamily D, polypeptide 6 (EC:1.14.14.1)
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
bta  Bos taurus (cow)
Pathway
Steroid hormone biosynthesis
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    282211 (CYP2D14)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    282211 (CYP2D14)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     282211 (CYP2D14)
Cytochrome P450 [BR:bta00199]
 Cytochrome P450, animal type
  CYP2 family
   282211 (CYP2D14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
5
AA seq 500 aa AA seqDB search
MGLLSGDTLGPLAVALLIFLLLLDLMHRRSRWAPRYPPGPTPLPVLGNLLQVDFEDPRPS
FNQLRRRFGNVFSLQQVWTPVVVLNGLAAVREALVYRSQDTADRPPPAVYEHLGYGPRAE
GVILARYGDAWAEQRRFSLTTLRNFGLGKKSLEQWVTEEASCSCAAFADQAGRPFSPMDL
LNKAVSNVIASLTFGCRFEYNDPRIIKLLDLTEDGLKEEPNLVRKVVEAVPVLLSIPGLA
ARVFPAQKAFMALIDELIAEQKMTRDPTQPPRHLTDAFLDEVKEAKGNPESSFNDENLRL
VVADLFSAGMVTTSTTLAWALLLMILHPDVQRRVQQEIDEVIGQVRRPEMGDQALMPFTV
AVVHEVQRFADIVPLGLPHMTSRDIEVQGFHIPKGTTLITNLSSVLKDETVWEKPFRFHP
EHFLDAQGRFVKQEAFIPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPAGQPRPSE
HGVFAFLVTPAPYQLCAVPR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggggctgctgtctggggacacgctggggcccctggccgtggccctgctcatcttcttg
ctcttgctggacctgatgcaccggcgctcacgttgggccccacgatacccaccaggcccc
acgccgctgccggtgctgggcaatctgctgcaggtggacttcgaggacccacgtcccagc
tttaaccagctgcggcgccgcttcgggaacgtgttcagcctgcagcaggtctggacgccg
gtagtcgtgctcaacgggctggcggctgtgcgcgaggcactggtgtaccgcagccaggac
actgccgaccgtccacctccggccgtctacgagcacctgggttacgggccgcgcgccgaa
ggagtgatcctggcgcgatatggggacgcctgggccgagcagcggcgcttctccctgacc
accctgcgcaacttcggcctggggaagaagtcactggagcagtgggtgaccgaggaggcc
tcgtgctcttgtgccgccttcgccgaccaggccggacgtccctttagccccatggacctc
ctgaataaagcagtgagcaacgtgatcgcctccctgaccttcgggtgccgcttcgagtac
aacgatcctcgcatcatcaagctgttggacttgacggaggatgggctgaaggaagagccc
aacttagtgcgcaaggtggtggaagctgtgccagtgctcctgagcatcccagggctggct
gccagggtcttcccggcgcagaaggccttcatggccctgattgatgagctgatcgctgag
cagaagatgacccgggacccgacccagccaccccgacacctgactgacgccttcctggat
gaggtgaaggaggccaaggggaaccccgagagcagcttcaatgatgagaacctgcgcctg
gtggtggccgacctgttctccgccgggatggtcaccacctcgaccacactggcctgggcc
ctcctcctcatgatcctgcaccctgacgtgcagcgacgggtccagcaggaaatcgatgag
gtgatagggcaggtgaggcgaccagagatgggggatcaggccctcatgcccttcaccgtg
gccgtggtccatgaggtgcaacgctttgcggacatcgtccccctgggattgccccacatg
acatcccgtgacatcgaggtgcagggcttccacatccccaaggggacgacactcatcacc
aacctgtcgtcagtgctgaaggacgagaccgtctgggagaagcccttccgcttccacccg
gagcacttcctggatgcccagggccgcttcgtcaagcaggaggccttcatacccttctct
gcaggccgccgcgcgtgcctcggggagcccctggcccgcatggagctcttcctcttcttc
accagcctcttgcagcatttcagcttctcggtgcctgccgggcagccccgccccagcgag
cacggtgtctttgccttcctggtgaccccagccccctaccagctctgtgcggtgccccgc
tag

DBGET integrated database retrieval system