KEGG   Bos taurus (cow): 282213Help
Entry
282213            CDS       T01008                                 

Gene name
CYP2E1, CYPIIE1
Definition
(RefSeq) cytochrome P450, family 2, subfamily E, polypeptide 1
  KO
K07415  cytochrome P450 family 2 subfamily E polypeptide 1 [EC:1.14.13.-]
Organism
bta  Bos taurus (cow)
Pathway
bta00140  Steroid hormone biosynthesis
bta00590  Arachidonic acid metabolism
bta00591  Linoleic acid metabolism
bta00980  Metabolism of xenobiotics by cytochrome P450
bta00982  Drug metabolism - cytochrome P450
bta00983  Drug metabolism - other enzymes
bta01100  Metabolic pathways
bta04932  Non-alcoholic fatty liver disease (NAFLD)
bta05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    282213 (CYP2E1)
   00590 Arachidonic acid metabolism
    282213 (CYP2E1)
   00591 Linoleic acid metabolism
    282213 (CYP2E1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    282213 (CYP2E1)
   00982 Drug metabolism - cytochrome P450
    282213 (CYP2E1)
   00983 Drug metabolism - other enzymes
    282213 (CYP2E1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    282213 (CYP2E1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    282213 (CYP2E1)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     282213 (CYP2E1)
Cytochrome P450 [BR:bta00199]
 Cytochrome P450, animal type
  CYP2 family
   282213 (CYP2E1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 282213
NCBI-ProteinID: NP_776955
BGD-bta: BT10031
Ensembl: ENSBTAG00000018365
UniProt: O18963 Q2TBV4
Position
26
AA seq 495 aa AA seqDB search
MAALGITVALLVWMATLLFISIWKHIYSSWKLPPGPFPLPIIGNLLQLDIKNIPKSFTRL
AERYGPVFTLYLGSQRAVVVHGYKPVKEVLLDYKNEFSGRGENPGFQMHKNNGIIFNNGS
TWRDTRRFSLTTLRDLGMGKQGNEQRIQREAHFLLEVLRKTQGQPFDPTFVVGFAPYNVI
SDILFHKRFDYKDQTSLRLMSLFNENFYLLSSPWIQLYNNFSDYLQYLPGSHRKLLKNVS
EVKSYALERVKDHQKSLEPSCPRGFLDTMLIEMAKERHSVDPMYTLENIAVTVADLLFAG
TETTSTTLRYGLLILMKYPEVEEKLHEEIDRVIGPSRIPAVKDRLDMPYLDAVVHEIQRF
IDLLPSNLLHEATQDTVFRGYVIPKGTVVIPTLDSVLHDRQEFPEPEKFKPEHFLNENGK
FKYSDHFKAFSAGKRVCVGEGLARMELFLLLAAILQHFNLKSLVDPKDIDLSPIAIGFGK
IPPRYKLCLIPRSKV
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggccgccctgggcatcacggtcgccctgctggtgtggatggccaccctgctgttcatc
tccatctggaagcacatctacagcagctggaaactgccccctggccctttcccactgccc
atcatcgggaatcttttacagctggatattaagaacattcccaaatccttcaccaggctg
gcggagaggtacgggccggtgttcaccctgtacctgggctctcagcgtgccgtggtcgtg
catggctacaagcccgtgaaggaggtcctgcttgactacaagaacgagttttctggcaga
ggagaaaaccctgggttccagatgcacaagaacaatgggatcattttcaacaatggatca
acctggcgggacacccgacggttctcgttgaccaccctccgtgacttagggatgggaaaa
cagggcaatgagcagcggatccagagggaggcccacttcctgctggaggtgctcaggaag
acccagggccagccctttgaccccacgtttgtcgtcggctttgcaccttacaatgtcatc
tctgacatcctcttccacaaacgctttgactataaagatcagacgagcctgaggctgatg
agtctgttcaacgagaacttctacctgctcagcagcccctggatccagctttataataat
ttctcagactacctacagtacctgcctggaagccatagaaagctactgaaaaatgtgtct
gaagtaaaaagttatgctttagaaagagtgaaggatcaccagaagtccctggaacccagc
tgcccccgaggcttcttggacaccatgctgatagaaatggccaaggaaagacacagtgtg
gaccctatgtacaccttggaaaacatcgctgtgactgtggccgacctgctctttgcgggg
acagagaccaccagcaccaccctgcgatacgggctcctgattctcatgaaatacccggag
gttgaagagaaacttcatgaagaaattgacagggtgattgggccaagccgaatccctgcc
gtcaaggacaggctggacatgccctacctggatgctgtggtacatgagattcagcgattc
atcgacctccttccctccaatctgctccacgaagcaacccaggacacagtgttcagagga
tatgtcatccccaagggcacagtcgtaattccgacgctggactctgtcttacacgatagg
caagagtttcctgaaccagagaagtttaaaccagagcactttctgaatgaaaatggaaag
ttcaagtacagtgaccattttaaggcgttttctgcaggaaagcgggtgtgtgttggagaa
ggcctggctcgcatggaactgttcctgctcttggccgccatcctgcagcactttaacttg
aagtcacttgttgaccccaaggatatcgacctcagccccattgcaattgggtttggcaag
atcccgccccgttacaaactctgtctcattccccgctcaaaagtgtga

DBGET integrated database retrieval system