KEGG   Bos taurus (cow): 282214Help
Entry
282214            CDS       T01008                                 

Gene name
CYP3A5, CYP3A28, CYP3A4
Definition
(RefSeq) cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4 (EC:1.14.14.1)
  KO
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
bta  Bos taurus (cow)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    282214 (CYP3A5)
   00591 Linoleic acid metabolism
    282214 (CYP3A5)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    282214 (CYP3A5)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    282214 (CYP3A5)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     282214 (CYP3A5)
Cytochrome P450 [BR:bta00199]
 Cytochrome P450, animal type
  CYP3 family
   282214 (CYP3A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
25
AA seq 507 aa AA seqDB search
MELIPSFSMETWVLLATSLVLLYIYGTYSYGLFKKLGIPGPRPVPYFGSTMAYHKGIPEF
DNQCFKKYGKMWGFYEGRQPMLAITDPDIIKTVLVKECYSVFTNRRIFGPMGIMKYAISL
AWDEQWKRIRTLLSPAFTSGKLKEMFPIIGQYGDMLVRNLRKEAEKGNPVNMKDMFGAYS
MDVITGTAFGVNIDSLNNPHDPFVEHSKNLLRFRPFDPFILSIILFPFLNPVFEILNITL
FPKSTVDFFTKSVKKIKESRLTDKQMNRVDLLQLMINSQNSKEIDNHKALSDIELVAQST
IFIFGGYETTSSTLSFIIYELTTHPHVQQKVQEEIDATFPNKAPPTYDALVQMEYLDMVV
NETLRMFPIAGRLERVCKKDVEIHGVTIPKGTTVLVPLFVLHNNPELWPEPEEFRPERFS
KNNKDSINPYVYLPFGTGPRNCLGMRFAIMNIKLALVRILQNFSFKPCKETQIPLKLYTQ
GLTQPEQPVILKVVPRGLGPQVEPDFL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggaactgatcccaagcttttccatggaaacctgggttctcctagctaccagcctggtg
ctcctctatatatatgggacttattcatatggactttttaagaagctggggattcctggg
ccaagacctgtgccctattttggaagtactatggcttaccacaagggtattccagagttt
gacaatcagtgttttaaaaagtatgggaaaatgtgggggttttatgaaggtcgacaacct
atgttggctatcacagatcctgatataatcaaaacagtactagtgaaagaatgttattct
gtcttcacaaaccggaggatttttggtccaatgggaattatgaaatatgccatctctctg
gcttgggatgaacaatggaagagaatacggacattgctgtctccagccttcaccagcgga
aagctcaaggagatgttccccatcattggccagtatggagatatgttggtgaggaacctg
aggaaggaagcagagaaaggcaatcccgtcaacatgaaagacatgtttggagcctacagc
atggatgtgattactggcacagcatttggagtgaatattgattccctcaacaacccacac
gatccctttgtggaacatagcaagaacctcttaagatttagacccttcgatccattcatt
ctttcaataatattatttccatttctcaacccagtttttgaaatattaaacattactctg
tttccaaaaagtactgtggactttttcacaaaatctgtaaagaagattaaagaaagtcgc
ctcacagataaacaaatgaatcgagtggatttacttcagctaatgattaattctcagaat
tccaaagaaattgacaaccataaagctctgtctgacatagaactcgtggcccaaagtact
atctttatttttggtggctatgagaccactagcagtactctttccttcattatatatgaa
ttgaccactcaccctcatgtccagcagaaggtgcaggaggaaattgatgcaactttccct
aataaggcccctcccacctacgatgccctggtgcagatggagtatcttgacatggtggtg
aatgagactctgagaatgtttccaattgctgggagacttgagagggtctgtaagaaggat
gtggaaatccacggggtgaccattcccaaagggacaaccgtgctggtgccactcttcgtt
cttcacaacaacccagagctctggccagagcccgaggagttccgtcccgaaaggttcagt
aagaataacaaggacagcataaatccttacgtctacctgccttttggaactggaccccga
aactgccttggcatgaggtttgccatcatgaacataaaacttgctcttgtcagaatcctg
cagaacttctccttcaaaccttgtaaagaaacacagatccccctgaaattatacactcaa
ggactcacgcagccagaacaacctgttattctgaaggttgtgcccagaggcctgggacca
caggtggagcctgactttctctaa

DBGET integrated database retrieval system