KEGG   Bos taurus (cow): 282271Help
Entry
282271            CDS       T01008                                 

Gene name
PLA2G15, ACS, LLPL, LPLA2, LYPLA3
Definition
phospholipase A2, group XV (EC:2.3.1.-)
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
bta  Bos taurus (cow)
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bta00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:bta04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
18
AA seq 407 aa AA seqDB search
MGCLCLYRSTLLTGGLLFLLMLADPAFPAGSRPPVVLVPGDMGNQLEAKLDKPSVVHYVC
SKRTDHYFTLWLNLELLLPVIIDCWIDNVRLIYNQTSHTTQFPEGVDVRVPGFGDTFSME
FLDPSKSSVGSYLHTMVESLVSWGYERGKDVRGAPYDWRRAPNENGPYFLALRKMIEEMY
QLYGGPVVLVAHSMGNMYMLYFLQHQPQDWKDKYIRAFVALGPPWGGVPKTLRVLASGDN
NRIPVIRSLKIRAQQRSAVSTTWLLPYSYTWSPQKVFVRTPKANYTLQDYRQFFQDIGFK
DGWSMRQETEGLVEATVPPGVRLHCLYGTGVPTPESFDYESFPDRDPKIHYGTGDGTVNL
QSALHCHTWRGLQKQEVSLQALPGNEHIAMLANTTTLAYLKRVLLGP
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgggttgcctctgcctctaccgctccaccctgctcacgggtggcctcttgttcctcctg
atgctcgcagatccggcgttcccggctggaagtcggccaccggtggtgctggtgcccggt
gacatgggcaaccagctggaggcaaagctggacaagccgtccgtcgtgcactacgtctgc
tccaagaggacggatcactacttcacactgtggctgaacctggagctgctgctgcccgtc
atcattgactgttggatcgacaatgtccggctgatctacaatcaaacgtcccacaccacc
cagtttcccgaaggtgtggatgtgcgtgtccctggctttggggacaccttctcaatggag
ttcctggaccccagcaaaagcagcgtgggttcctatttacataccatggtggaaagcctt
gtgagctggggctacgaacgaggcaaggatgtccggggggccccctacgactggcgccga
gctccaaatgaaaacgggccctacttcctggccctccgcaagatgattgaggagatgtac
cagctgtacgggggccctgtggtgctggtggcccacagtatgggcaacatgtacatgctc
tactttctgcagcatcagccacaggactggaaggacaagtacatccgtgctttcgtagca
ctgggtccgccctgggggggcgtgcccaagaccctgcgtgtcctggcctcaggagacaac
aaccggatcccggtcatcaggtccctgaagatccgggcacagcagcggtctgccgtctcc
accacttggctgctgccctacagctatacctggtcaccgcagaaagtcttcgtgcgcaca
cctaaggccaactacacgctgcaggactaccgccagttcttccaggacatcggcttcaaa
gacggctggtccatgcggcaggagacggaggggctggttgaggccacagtgccgcctggc
gtgcgactgcactgcctctatggcacgggggtccccacgccagagtcctttgactacgag
agcttcccagaccgtgacccaaaaatccactatggcaccggtgatggcactgtgaacttg
cagagtgccctgcactgccatacctggcgtggcctccagaagcaagaagtgtcattgcag
gcgcttccaggcaatgagcacatcgctatgctggccaacaccactaccctggcctacctg
aaacgtgtgcttcttggaccctga

DBGET integrated database retrieval system