KEGG   Bos taurus (cow): 282301Help
Entry
282301            CDS       T01008                                 

Gene name
PDGFRA
Definition
platelet-derived growth factor receptor, alpha polypeptide (EC:2.7.10.1)
Orthology
K04363  
platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
bta  Bos taurus (cow)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
HTLV-I infection
Pathways in cancer
MicroRNAs in cancer
Glioma
Prostate cancer
Melanoma
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    282301 (PDGFRA)
   04015 Rap1 signaling pathway
    282301 (PDGFRA)
   04010 MAPK signaling pathway
    282301 (PDGFRA)
   04020 Calcium signaling pathway
    282301 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    282301 (PDGFRA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    282301 (PDGFRA)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    282301 (PDGFRA)
  Cell motility
   04810 Regulation of actin cytoskeleton
    282301 (PDGFRA)
  Cellular commiunity
   04510 Focal adhesion
    282301 (PDGFRA)
   04540 Gap junction
    282301 (PDGFRA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    282301 (PDGFRA)
   05206 MicroRNAs in cancer
    282301 (PDGFRA)
   05214 Glioma
    282301 (PDGFRA)
   05218 Melanoma
    282301 (PDGFRA)
   05215 Prostate cancer
    282301 (PDGFRA)
  Infectious diseases
   05166 HTLV-I infection
    282301 (PDGFRA)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     282301 (PDGFRA)
Protein kinases [BR:bta01001]
 Tyrosine protein kinases
  PDGFR family [OT]
   282301 (PDGFRA)
Enzyme-linked receptors [BR:bta01020]
 Receptor tyrosine kinases
  RTK class III (PDGF receptor family)
   282301 (PDGFRA)
Cytokine receptors [BR:bta04050]
 Receptor tyrosine kinase
  RTK class III (PDGF receptor family)
   282301 (PDGFRA)
Cellular antigens [BR:bta04090]
 Proteins
  282301 (PDGFRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
6
AA seq 1089 aa AA seqDB search
MGTSHWALLVLGCLFTGPSLILCQLSLPSILPNENERVVQLNSSFSLRCFGESEVSWQYP
MSEEEYPDVEIRNEENNSGLFVTVLEVVSASAAHTGLYTCYYNHTQMDENEIEGRHIYIY
VPDPDVAFVPLGMTDSLVIVEDEDSVIIPCRTTDPETPVTLLSSEGIVPASYDSRQGFKG
TFSVGLYICEATVRGKKFQTIPFNVYAYTATSKLDLEMESPKTVYKAGESIVVTCTVFNN
EVVDFQWTYPGQMKGKGITRLEETKFPSIKLVYTLRVPEATVKDSGDYECAAHQATKEVK
KMRNVTISVHEKGFIEIKPNFNLLEAVNLHEVKHFVVDVQAYPPPKITWLKDNLTLIENL
TEITTDIEKIQEISYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSNGGQTVRCTAEGTPLPDIEWMVCKDIKKCNNETSWTVLANNVSNIITGVHPRD
RSTVEGQVTFAKVEETIAVRCLAKNLLGVESRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRALYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atggggacttcccattgggcactcctggtcttaggctgtctcttcacagggccgagccta
atcctctgccagctttcattaccctccatcctgcccaatgaaaatgagagggttgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagtaccccgacgtggaaatcagaaacgaggagaacaacagtggcctt
tttgtgacagtgctggaagtggtcagcgcctcggcggcccacactgggctgtacacttgc
tattacaaccacacgcagatggacgagaacgagatcgagggcaggcacatttacatctac
gtgccagacccagatgtagccttcgtacctctaggaatgacagattccttggtcatcgtg
gaggacgaagattcggtcatcatcccatgccgcacgactgatcctgagactccagtgacc
ttactcagcagtgaggggatagtgcctgcctcctatgacagcagacaaggctttaaagga
accttcagtgtcgggctctatatctgtgaggccacggtcagagggaagaagttccagacc
attccattcaatgtttatgcttacacagcaacatcaaaacttgatctggaaatggaatct
cctaagactgtgtataaggcaggcgaatcaattgtggtcacctgcaccgtctttaacaac
gaggtggttgactttcagtggacttaccctggacaaatgaaaggcaaaggcatcacgagg
ctggaggaaaccaagttcccgtccatcaagttggtgtacactctgagggttcccgaggcc
acggtgaaagacagtggagattacgaatgtgctgcccaccaggccaccaaggaggtcaaa
aagatgaggaacgtcaccatttctgttcacgagaaaggatttattgaaatcaaacccaac
tttaacctgttggaagctgtcaacctgcatgaagtcaagcattttgtggtggatgtgcag
gcctatccccctcccaagataacctggctaaaggacaacctgactctgattgagaatctc
acggagatcaccactgacatagaaaagattcaggaaataagttatcgaagcaaattaaag
ctgatccgagcaaaggaagaagacagcggccattatactattgtagttcaaaatgaagat
gatgtgaagagctatacttttgaactcttgactcaagttccatcctccatactggacttg
gttgacgaccaccatggctctaatgggggccagactgtgagatgcacagccgaagggacc
cctcttcctgatatcgagtggatggtttgcaaggatattaagaaatgtaacaatgaaact
tcatggacagttttggccaacaacgtttcaaacatcatcacaggggtccacccccgagac
aggagcacagtggaaggccaggtgacatttgccaaagtggaggagaccattgcagtccgg
tgtctggccaagaacctcctcggggtggaaagccgagagctgaagctggtggctcccact
ctgcgctctgagctcactgtggcggctgctgtcctggtgttgttggtgattgtgatcatc
tcactcattgtcctggtcgtcatttggaaacagaaaccaaggtatgaaatccgttggagg
gtcattgaatcaatcagccctgatggacatgaatacatttatgtggacccgatgcagctg
ccttacgactcgagatgggagtttccaagagatggactcgtgcttggtcggatcctgggg
tctggtgcatttgggaaagtggttgaaggaactgcttatggattaagtcggtctcaacct
gtcatgaaagtagcagtgaagatgctaaaacccacagccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgacccacctggggccacatttaaacatcgtgaacttg
ctgggcgcctgcaccaagtcaggccccatttacatcatcactgagtactgcttctatggg
gatttggtcaactatttgcataagaatagggacagcttcctgagccaccatccagagaag
ccaaagaaagagctggacatttttggattgaacccggctgacgaaagcacaagaagttac
gttatcttatcttttgaaaataatggtgactacatggacatgaagcaagctgacacgaca
cagtatgtccccatgctggagagaaaagaggtttctaaatactcggacatccagagagcg
ctgtatgatcgcccagcctcgtataagaagaaatccatgttagactcagaagtcaaaaac
ctcctttcagatgataactcagaaggcctgactttgttggatttgttgagctttacctat
caagtcgcccgaggaatggagtttttggcttcaaaaaattgtgtccatcgggacctggcg
gctcgcaacgtcctcctggcgcaagggaaaatcgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattcgaactacgtgtccaaaggcagtacctttctccccgtgaag
tggatggctcctgagagcatctttgacaacctgtacaccacgctgagtgacgtctggtcc
tatggcatcctgctctgggagatcttttcccttggtggcacaccctaccctggcatgatg
gtggactctacattctacaataagatcaagagtggataccggatggccaagcctgaccat
gccaccagtgaagtctacgagatcatggtgaagtgctggaacagtgagccggagaagaga
ccctccttttaccacctgagtgaaattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaagatccacctggactttctgaagagtgaccatcccgctgtggcacgcatg
cgcgtggactccgacaacgcctacattggcgtcacctacaaaaatgaggaagacaagctg
aaggactgggagggtggcctcgacgagcagaggctgagtgcagatagcggctacatcatc
cctctgcccgacatcgaccctgttcctgaggaggaagacctgggcaagaggaacagacac
agctcacagacctctgaagagagtgccattgagacaggttccagcagttctacgttcatc
aagagagaggatgagaccatcgaggacatcgacatgatggacgacattggcatagactcc
tcggatctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system