KEGG   Bos taurus (cow): 282306Help
Entry
282306            CDS       T01008                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
bta  Bos taurus (cow)
Pathway
bta00562  Inositol phosphate metabolism
bta01521  EGFR tyrosine kinase inhibitor resistance
bta01522  Endocrine resistance
bta01524  Platinum drug resistance
bta04012  ErbB signaling pathway
bta04014  Ras signaling pathway
bta04015  Rap1 signaling pathway
bta04024  cAMP signaling pathway
bta04062  Chemokine signaling pathway
bta04066  HIF-1 signaling pathway
bta04068  FoxO signaling pathway
bta04070  Phosphatidylinositol signaling system
bta04071  Sphingolipid signaling pathway
bta04072  Phospholipase D signaling pathway
bta04140  Autophagy - animal
bta04150  mTOR signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04152  AMPK signaling pathway
bta04210  Apoptosis
bta04211  Longevity regulating pathway
bta04213  Longevity regulating pathway - multiple species
bta04218  Cellular senescence
bta04360  Axon guidance
bta04370  VEGF signaling pathway
bta04380  Osteoclast differentiation
bta04510  Focal adhesion
bta04550  Signaling pathways regulating pluripotency of stem cells
bta04611  Platelet activation
bta04620  Toll-like receptor signaling pathway
bta04625  C-type lectin receptor signaling pathway
bta04630  Jak-STAT signaling pathway
bta04650  Natural killer cell mediated cytotoxicity
bta04660  T cell receptor signaling pathway
bta04662  B cell receptor signaling pathway
bta04664  Fc epsilon RI signaling pathway
bta04666  Fc gamma R-mediated phagocytosis
bta04668  TNF signaling pathway
bta04670  Leukocyte transendothelial migration
bta04722  Neurotrophin signaling pathway
bta04725  Cholinergic synapse
bta04750  Inflammatory mediator regulation of TRP channels
bta04810  Regulation of actin cytoskeleton
bta04910  Insulin signaling pathway
bta04914  Progesterone-mediated oocyte maturation
bta04915  Estrogen signaling pathway
bta04917  Prolactin signaling pathway
bta04919  Thyroid hormone signaling pathway
bta04923  Regulation of lipolysis in adipocytes
bta04926  Relaxin signaling pathway
bta04930  Type II diabetes mellitus
bta04931  Insulin resistance
bta04932  Non-alcoholic fatty liver disease (NAFLD)
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta04960  Aldosterone-regulated sodium reabsorption
bta04973  Carbohydrate digestion and absorption
bta05100  Bacterial invasion of epithelial cells
bta05142  Chagas disease (American trypanosomiasis)
bta05146  Amoebiasis
bta05160  Hepatitis C
bta05161  Hepatitis B
bta05162  Measles
bta05164  Influenza A
bta05165  Human papillomavirus infection
bta05166  HTLV-I infection
bta05167  Kaposi's sarcoma-associated herpesvirus infection
bta05169  Epstein-Barr virus infection
bta05200  Pathways in cancer
bta05203  Viral carcinogenesis
bta05205  Proteoglycans in cancer
bta05210  Colorectal cancer
bta05211  Renal cell carcinoma
bta05212  Pancreatic cancer
bta05213  Endometrial cancer
bta05214  Glioma
bta05215  Prostate cancer
bta05218  Melanoma
bta05220  Chronic myeloid leukemia
bta05221  Acute myeloid leukemia
bta05222  Small cell lung cancer
bta05223  Non-small cell lung cancer
bta05224  Breast cancer
bta05225  Hepatocellular carcinoma
bta05226  Gastric cancer
bta05230  Central carbon metabolism in cancer
bta05231  Choline metabolism in cancer
bta05418  Fluid shear stress and atherosclerosis
Module
bta_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    282306 (PIK3CA)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    282306 (PIK3CA)
   04015 Rap1 signaling pathway
    282306 (PIK3CA)
   04012 ErbB signaling pathway
    282306 (PIK3CA)
   04370 VEGF signaling pathway
    282306 (PIK3CA)
   04630 Jak-STAT signaling pathway
    282306 (PIK3CA)
   04668 TNF signaling pathway
    282306 (PIK3CA)
   04066 HIF-1 signaling pathway
    282306 (PIK3CA)
   04068 FoxO signaling pathway
    282306 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    282306 (PIK3CA)
   04072 Phospholipase D signaling pathway
    282306 (PIK3CA)
   04071 Sphingolipid signaling pathway
    282306 (PIK3CA)
   04024 cAMP signaling pathway
    282306 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    282306 (PIK3CA)
   04152 AMPK signaling pathway
    282306 (PIK3CA)
   04150 mTOR signaling pathway
    282306 (PIK3CA)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    282306 (PIK3CA)
  Cell growth and death
   04210 Apoptosis
    282306 (PIK3CA)
   04218 Cellular senescence
    282306 (PIK3CA)
  Cellular community - eukaryotes
   04510 Focal adhesion
    282306 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    282306 (PIK3CA)
  Cell motility
   04810 Regulation of actin cytoskeleton
    282306 (PIK3CA)
 Organismal Systems
  Immune system
   04611 Platelet activation
    282306 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    282306 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    282306 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    282306 (PIK3CA)
   04660 T cell receptor signaling pathway
    282306 (PIK3CA)
   04662 B cell receptor signaling pathway
    282306 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    282306 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    282306 (PIK3CA)
   04670 Leukocyte transendothelial migration
    282306 (PIK3CA)
   04062 Chemokine signaling pathway
    282306 (PIK3CA)
  Endocrine system
   04910 Insulin signaling pathway
    282306 (PIK3CA)
   04923 Regulation of lipolysis in adipocyte
    282306 (PIK3CA)
   04915 Estrogen signaling pathway
    282306 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    282306 (PIK3CA)
   04917 Prolactin signaling pathway
    282306 (PIK3CA)
   04926 Relaxin signaling pathway
    282306 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    282306 (PIK3CA)
  Digestive system
   04973 Carbohydrate digestion and absorption
    282306 (PIK3CA)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    282306 (PIK3CA)
  Nervous system
   04725 Cholinergic synapse
    282306 (PIK3CA)
   04722 Neurotrophin signaling pathway
    282306 (PIK3CA)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    282306 (PIK3CA)
  Development
   04360 Axon guidance
    282306 (PIK3CA)
   04380 Osteoclast differentiation
    282306 (PIK3CA)
  Aging
   04211 Longevity regulating pathway - mammal
    282306 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    282306 (PIK3CA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    282306 (PIK3CA)
   05230 Central carbon metabolism in cancer
    282306 (PIK3CA)
   05231 Choline metabolism in cancer
    282306 (PIK3CA)
   05205 Proteoglycans in cancer
    282306 (PIK3CA)
   05203 Viral carcinogenesis
    282306 (PIK3CA)
   05210 Colorectal cancer
    282306 (PIK3CA)
   05212 Pancreatic cancer
    282306 (PIK3CA)
   05225 Hepatocellular carcinoma
    282306 (PIK3CA)
   05226 Gastric cancer
    282306 (PIK3CA)
   05214 Glioma
    282306 (PIK3CA)
   05221 Acute myeloid leukemia
    282306 (PIK3CA)
   05220 Chronic myeloid leukemia
    282306 (PIK3CA)
   05218 Melanoma
    282306 (PIK3CA)
   05211 Renal cell carcinoma
    282306 (PIK3CA)
   05215 Prostate cancer
    282306 (PIK3CA)
   05213 Endometrial cancer
    282306 (PIK3CA)
   05224 Breast cancer
    282306 (PIK3CA)
   05222 Small cell lung cancer
    282306 (PIK3CA)
   05223 Non-small cell lung cancer
    282306 (PIK3CA)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    282306 (PIK3CA)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    282306 (PIK3CA)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    282306 (PIK3CA)
   04931 Insulin resistance
    282306 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    282306 (PIK3CA)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    282306 (PIK3CA)
   05166 HTLV-I infection
    282306 (PIK3CA)
   05162 Measles
    282306 (PIK3CA)
   05164 Influenza A
    282306 (PIK3CA)
   05161 Hepatitis B
    282306 (PIK3CA)
   05160 Hepatitis C
    282306 (PIK3CA)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    282306 (PIK3CA)
   05169 Epstein-Barr virus infection
    282306 (PIK3CA)
   05165 Human papillomavirus infection
    282306 (PIK3CA)
   05146 Amoebiasis
    282306 (PIK3CA)
   05142 Chagas disease (American trypanosomiasis)
    282306 (PIK3CA)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    282306 (PIK3CA)
   01524 Platinum drug resistance
    282306 (PIK3CA)
   01522 Endocrine resistance
    282306 (PIK3CA)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     282306 (PIK3CA)
Membrane trafficking [BR:bta04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    282306 (PIK3CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC DUF4135 Ribosomal_S15
Motif
Other DBs
NCBI-GeneID: 282306
NCBI-ProteinID: NP_776999
Ensembl: ENSBTAG00000009232
UniProt: P32871
Structure
PDB: 

Jmol
Position
1
AA seq 1068 aa AA seqDB search
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatgggatgatagtgactttagaatgcctccgtgaggct
acgttaataacgataaagcatgaactatttaaagaagcaagaaaataccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
atcggcatgccagtgtgtgaattcgatatggttaaagatccagaagtacaggacttccga
agaaatattctcaatgtttgtaaagaagctgtggatcttagggatcttaattcacctcat
agtagagcaatgtatgtttatcctccaaatgtagaatcttcaccagaactgccaaagcac
atatataataaattggataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaaacagaagtatactctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcatctgaacaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgctgatggctaaagaaagcctctattctcaactgccaatggac
tgttttacaatgccatcatattccagacgcatctccacagctacgccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcactcagaataaaaattctttgt
gcaacctatgtgaatgtaaatattcgagacattgacaagatttatgttcgaacaggtatc
taccatggaggagaacccttatgtgataatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctgaattacgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcctggggaaatataaacttgtttgattacacagatactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggactagaagatttgctgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgtttagagttggagtttgactggttc
agcagtgtggtaaagtttccagatatgtcagtgattgaagagcatgccaattggtctgta
tcccgtgaagcaggatttagttattcccatgcaggactgagtaacagactagctagagac
aatgaattaagagaaaatgataaagaacagctccgagcaatttgtacacgagatcctcta
tctgaaatcactgagcaagagaaagattttctgtggagccacagacactattgtgtaact
atccccgaaattctacccaaattgcttctgtctgttaaatggaactctagagatgaagta
gctcagatgtactgcttggtaaaagattggcctccaatcaagcctgaacaggctatggag
cttctggactgcaattacccagatcctatggttcgaggttttgctgttcggtgcttagaa
aaatatttaacagatgacaaactttctcagtacctaattcagctagtacaggtactaaaa
tatgaacagtatttggataacctgcttgtgagatttttactcaaaaaagcgttaactaat
caaaggatcggtcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agtcagaggtttggcctgcttttggagtcctattgccgtgcatgtgggatgtatctgaag
caccttaataggcaagttgaggctatggaaaagctcattaacttgactgacattctcaaa
caagagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcaaatgcgg
cgaccagatttcatggatgctctccagggctttctgtctcctctaaaccctgctcatcag
ctgggaaatctcaggcttgaagagtgtcgaattatgtcttctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagaattactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacccttcagattattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggatgtctgtca
atcggtgactgtgtgggacttatcgaggtggtgagaaattctcacactataatgcagatt
cagtgtaaaggaggcctgaaaggtgcactgcagtttaacagccacacactccatcagtgg
ctcaaagacaagaacaagggggaaatatatgatgcggccatcgatttgtttacacgatca
tgtgctggatattgtgttgccaccttcattttgggaattggagatcgtcacaatagtaat
atcatggttaaagatgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgagagcgcgtgccgtttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactgcaatcttttgatgatattgca
tacattcgaaagaccctagctttagataaaactgagcaagaggctttggagtatttcatg
aaacaaatgaatgatgcacaccatggtggctggacaacaaaaatggattggatcttccac
acaattaagcagcatgctttgaactga

DBGET integrated database retrieval system