KEGG   Bos taurus (cow): 282318Help
Entry
282318            CDS       T01008                                 

Gene name
PPP1CC
Definition
(RefSeq) protein phosphatase 1 catalytic subunit gamma
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
bta  Bos taurus (cow)
Pathway
bta03015  mRNA surveillance pathway
bta04022  cGMP-PKG signaling pathway
bta04024  cAMP signaling pathway
bta04114  Oocyte meiosis
bta04218  Cellular senescence
bta04261  Adrenergic signaling in cardiomyocytes
bta04270  Vascular smooth muscle contraction
bta04390  Hippo signaling pathway
bta04510  Focal adhesion
bta04611  Platelet activation
bta04720  Long-term potentiation
bta04728  Dopaminergic synapse
bta04750  Inflammatory mediator regulation of TRP channels
bta04810  Regulation of actin cytoskeleton
bta04910  Insulin signaling pathway
bta04921  Oxytocin signaling pathway
bta04931  Insulin resistance
bta05031  Amphetamine addiction
bta05034  Alcoholism
bta05168  Herpes simplex infection
bta05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    282318 (PPP1CC)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    282318 (PPP1CC)
   04024 cAMP signaling pathway
    282318 (PPP1CC)
   04022 cGMP - PKG signaling pathway
    282318 (PPP1CC)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    282318 (PPP1CC)
   04218 Cellular senescence
    282318 (PPP1CC)
  Cellular community - eukaryotes
   04510 Focal adhesion
    282318 (PPP1CC)
  Cell motility
   04810 Regulation of actin cytoskeleton
    282318 (PPP1CC)
 Organismal Systems
  Immune system
   04611 Platelet activation
    282318 (PPP1CC)
  Endocrine system
   04910 Insulin signaling pathway
    282318 (PPP1CC)
   04921 Oxytocin signaling pathway
    282318 (PPP1CC)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    282318 (PPP1CC)
   04270 Vascular smooth muscle contraction
    282318 (PPP1CC)
  Nervous system
   04728 Dopaminergic synapse
    282318 (PPP1CC)
   04720 Long-term potentiation
    282318 (PPP1CC)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    282318 (PPP1CC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    282318 (PPP1CC)
  Substance dependence
   05031 Amphetamine addiction
    282318 (PPP1CC)
   05034 Alcoholism
    282318 (PPP1CC)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    282318 (PPP1CC)
  Infectious diseases
   05168 Herpes simplex infection
    282318 (PPP1CC)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     282318 (PPP1CC)
Protein phosphatases and associated proteins [BR:bta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     282318 (PPP1CC)
Transcription machinery [BR:bta03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     282318 (PPP1CC)
Messenger RNA biogenesis [BR:bta03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     282318 (PPP1CC)
Spliceosome [BR:bta03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    282318 (PPP1CC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 282318
NCBI-ProteinID: NP_777006
Ensembl: ENSBTAG00000011198
UniProt: P61287
Position
17
AA seq 323 aa AA seqDB search
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRGMITKQAKK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcggatatagataaactcaacatcgacagcatcatccaacggctgctggaagtgaga
gggtccaagcctggtaagaatgtccagctacaggagaatgaaatcagaggactgtgctta
aagtcccgagagatctttctcagtcagcctatcctgctagaacttgaagcaccactcaag
atatgtggtgatatccatgggcaatactatgatttgcttcgactttttgagtacggtggt
ttcccgccagaaagcaattacctgtttcttggggactatgtggacaggggaaaacaatca
ctggagactatctgcctcttgttggcttacaaaatcaaatatcccgagaatttttttctt
ctcagaggaaaccacgaatgtgccagcatcaatagaatttatggattttatgatgaatgt
aaaagaagatataacattaaactatggaaaactttcacagactgctttaactgtttaccg
atagcagccatcgtggatgagaaaatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgcgaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggatacgaattttttgcaaag
aggcagttggtcactctgttttctgcgcccaattattgtggagagtttgacaatgcaggt
gccatgatgagtgtggacgaaacactaatgtgttcttttcagatattaaagcctgcagag
aaaaagaagcctaatgccacgagacccgtcacacctccaaggggtatgatcacaaagcaa
gcaaagaaatag

DBGET integrated database retrieval system