KEGG   Bos taurus (cow): 282340Help
Entry
282340            CDS       T01008                                 

Gene name
RNASE1, RNS1
Definition
ribonuclease, RNase A family, 1 (pancreatic) (EC:3.1.27.5)
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     282340 (RNASE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Structure
PDB: 
1DY5 2E3W 1KF3 2P45 1KF2 1KF4 1KF5 1KF7 1KF8 1O0O 1O0H 1RUV 7RSA 3QL1 3I6F 3I6H 3I6J 3I67 2QCA 2P49 3DXG 3DXH 3DIB 1FS3 1EIC 1EID 1EIE 1RPG 1YMN 3RN3 3QL2 3OQY 3MZQ 3MZR 2G8Q 1Z6S 1YMR 1YMW 1O0M 1O0N 1O0F 1IZP 1IZR 1RHB 1RNC 1RND 1RAT 2RAT 3RAT 4RAT 5RAT 6RAT 7RAT 8RAT 9RAT 1Z6D 3LXO 4AO1 3D6O 3JW1 3FL3 3DI7 3DI8 3DIC 3DH5 3DH6 3D7B 3D6P 3D6Q 2OP2 1A5P 3RSD 4RSD 1BEL 1ROB 1RNU 1RNV 2RNS 4L55 3EUX 2P43 3EV3 3EV5 1W4Q 4J60 4J61 1W4P 1RBW 1RBX 4G8V 3A1R 2W5G 2W5K 2W5L 2G8R 1F0V 1C9V 1QHC 3RSP 1AFK 1AFL 1RAS 1RBD 1RBH 2XOI 2XOG 3D8Y 3QSK 1RBE 3EV0 3EV6 4J64 4J68 1JVU 4K7M 4J5Z 4G8Y 2W5M 2P42 2P44 2APQ 1Z3L 1IZQ 1JN4 1C9X 1C8W 1XPS 1RNW 1RNN 1RHA 1RBF 1RBG 1RBI 1SRN 8RSA 9RSA 3EUZ 2G4W 2RLN 4J67 4J69 4G90 3FL1 2P4A 1C0B 1XPT 1RNZ 1LSQ 1RNX 1RNO 1RCA 1RAR 3EV4 3FL0 3EUY 2G4X 4J65 3D8Z 3FKZ 3EV1 3DI9 1Z3M 1Z3P 1U1B 1KH8 1EOS 1EOW 1C0C 3RSK 1AQP 1AFU 1RNY 1RNM 1RNQ 1SSC 1SSA 1SSB 1RBC 3SRN 4SRN 6RSA 1RSM 5RSA 3EV2 4J62 4J63 4J66 4J6A 1JVT 3RH1 1J80 4RSK 1A2W 1RBN 3RID 1JVV 1JS0 1J81 1RPF 1RPH 4MXF 1J7Z 1FEV 1D5D 1D5E 1D5H 3OR0 2P48 1J82 1CJR 1A5Q 1RCN 3I7W 3I7Y 2W5I 3OQZ 2P46 2P47 1DFJ 1RTA 1RTB 1RBB 3I7X 2E33 1RBJ 1BZQ 1CJQ 2BLP 2BLZ 1WBU 1W4O 2AAS
Thumbnails

Jmol
Position
10
AA seq 150 aa AA seqDB search
MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRN
LTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPN
CAYKTTQANKHIIVACEGNPYVPVHFDASV
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaagtccctggtcctgttgtcgctgttggtcctggtgctgctgctggtgcgg
gtccagccttccctgggcaaggaaactgcagcagccaagtttgagcggcagcacatggac
tccagcacttccgctgccagcagctccaactactgtaaccagatgatgaagagccggaac
ctgaccaaagatcgatgcaagccagtgaacacctttgtgcacgagtccctggctgatgtc
caggccgtgtgctcccagaaaaatgttgcctgcaagaatgggcagaccaattgctaccag
agctactccaccatgagcatcaccgactgccgtgagaccggcagctccaagtaccccaac
tgtgcctacaagaccacccaggcgaataaacacatcattgtggcttgtgagggaaacccg
tacgtgccagtccactttgatgcttcagtgtag

DBGET integrated database retrieval system