KEGG   Bos taurus (cow): 282488Help
Entry
282488            CDS       T01008                                 

Gene name
FAS, APO1, TNFRSF6
Definition
(RefSeq) Fas cell surface death receptor
  KO
K04390  
tumor necrosis factor receptor superfamily member 6
Organism
bta  Bos taurus (cow)
Pathway
Platinum drug resistance
MAPK signaling pathway
Cytokine-cytokine receptor interaction
p53 signaling pathway
Apoptosis
Natural killer cell mediated cytotoxicity
TNF signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Type I diabetes mellitus
Alzheimer's disease
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Pathways in cancer
Proteoglycans in cancer
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    282488 (FAS)
   04668 TNF signaling pathway
    282488 (FAS)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    282488 (FAS)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    282488 (FAS)
   04115 p53 signaling pathway
    282488 (FAS)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    282488 (FAS)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    282488 (FAS)
   05205 Proteoglycans in cancer
    282488 (FAS)
  Immune diseases
   05320 Autoimmune thyroid disease
    282488 (FAS)
   05330 Allograft rejection
    282488 (FAS)
   05332 Graft-versus-host disease
    282488 (FAS)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    282488 (FAS)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    282488 (FAS)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    282488 (FAS)
  Infectious diseases
   05162 Measles
    282488 (FAS)
   05164 Influenza A
    282488 (FAS)
   05161 Hepatitis B
    282488 (FAS)
   05168 Herpes simplex infection
    282488 (FAS)
   05142 Chagas disease (American trypanosomiasis)
    282488 (FAS)
   05143 African trypanosomiasis
    282488 (FAS)
  Drug resistance
   01524 Platinum drug resistance
    282488 (FAS)
Cytokine receptors [BR:bta04050]
 TNF receptor family
  282488 (FAS)
Cellular antigens [BR:bta04090]
 Proteins
  282488 (FAS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
26q13
AA seq 323 aa AA seqDB search
MSGIWVHLSLIFISVSGPLSKGENAHMAGINSEGLKLNITEANSCQEGLYREHQFCCQPC
PPGKRKNGDCKRDGDTPECVLCSEGNEYTDKSHHSDKCIRCSICDEEHGLEVEQNCTRTR
NTKCRCKSNFFCNSSPCEHCNPCTTCEHGIIEKCTPTSNTKCKGSRSHANSLWALLILLI
PIVLIIYKVVKSRERNKKNDYCNSAASNDEGRQLNLTDVDLGKYIPSIAEQMRITEVKEF
VRKNGMEEAKIDDIMHDNVHETAEQKVQLLRNWYQSHGKKNAYCTLTKSLPKALAEKICD
IVMKDITNERENANLQNENENLV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggatctgggttcacttgtcactgatatttatctctgtttctggaccattgtct
aaaggtgaaaatgcccacatggctggtatcaactctgaggggctgaaattgaatattact
gaagcgaactcctgccaagaaggcctgtatcgtgagcaccagttttgttgtcagccttgt
cctcctggcaaacggaaaaacggtgattgcaaacgcgacggagatacaccagaatgtgtg
ctctgctcagaggggaacgagtacacagacaagagccatcattctgacaaatgcataaga
tgtagtatctgtgatgaagaacatgggctagaagtggaacaaaactgtactcggacccgg
aataccaagtgcagatgcaaatcgaactttttttgtaacagttctccgtgtgaacactgt
aacccttgcaccacgtgtgaacatggaatcattgagaaatgcacaccaacgagcaacacc
aaatgcaaaggatccagatctcacgcaaacagtttatgggccctcctgatcctcctcatc
ccaatagttctaataatatacaaagtggtgaaaagtcgagagaggaataaaaaaaatgat
tattgcaactctgcagcctcaaatgatgaagggaggcaactgaatttaacagatgttgac
ttgggtaaatatatccctagtattgctgaacaaatgagaataactgaagttaaagagttt
gttcggaagaacggtatggaggaagccaaaatagatgatatcatgcatgacaatgtccat
gaaacagctgaacagaaggtccaactgctccgcaattggtatcaaagtcatgggaagaaa
aatgcatattgcactttgactaaaagtctcccaaaagctcttgcagagaaaatttgtgac
atagtcatgaaggacattactaatgaacgtgaaaatgcaaacttgcaaaatgaaaatgaa
aacttggtttaa

DBGET integrated database retrieval system