KEGG   Bos taurus (cow): 282603Help
Entry
282603            CDS       T01008                                 

Gene name
PRSS2, TRYP8
Definition
protease, serine, 2 (trypsin 2) (EC:3.4.21.4)
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
bta  Bos taurus (cow)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    282603 (PRSS2)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    282603 (PRSS2)
   04974 Protein digestion and absorption
    282603 (PRSS2)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    282603 (PRSS2)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     282603 (PRSS2)
Peptidases [BR:bta01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   282603 (PRSS2)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   282603 (PRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
4
AA seq 247 aa AA seqDB search
MHPLLILAFVGAAVAFPSDDDDKIVGGYTCAENSVPYQVSLNAGYHFCGGSLINDQWVVS
AAHCYQYHIQVRLGEYNIDVLEGGEQFIDASKIIRHPKYSSWTLDNDILLIKLSTPAVIN
ARVSTLALPSACASGSTECLISGWGNTLSSGVNYPDLLQCLEAPLLSHADCEASYPGEIT
NNMICAGFLEGGKDSCQGDSGGPVACNGQLQGIVSWGYGCAQKGKPGVYTKVCNYVDWIQ
ETIAANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcatcccctgctgatccttgcctttgtgggagctgctgtggctttcccctcggacgac
gatgacaagatcgtcgggggctacacctgcgcggagaattctgtcccttaccaggtgtcc
ctgaatgctggctaccacttctgcgggggctccctcatcaatgaccagtgggtggtgtcc
gcggctcactgctaccagtaccacatccaggtgaggctgggagaatacaacattgatgtc
ttggagggtggtgagcagttcatcgatgcgtccaagatcatccgccaccccaagtacagc
agctggactctggacaatgacatcctgctgatcaaactctccacgcctgcggtcatcaat
gcccgggtgtccaccttggctctgcccagtgcctgtgcttccggcagcaccgagtgcctc
atctccggctggggcaacaccctgagcagtggcgtcaactacccggacctgctgcaatgc
ctggaggccccgctgctgagccacgccgactgtgaagcctcgtaccctggagagatcact
aacaacatgatctgcgctggcttcctggaaggaggcaaggattcctgccagggtgactct
ggcggccctgtggcttgcaacggacagctccagggcattgtgtcttggggctacggctgt
gcccagaagggcaagcctggggtctacaccaaggtctgcaactacgtggactggattcag
gagaccatcgccgccaacagctga

DBGET integrated database retrieval system