KEGG   Bos taurus (cow): 282603Help
Entry
282603            CDS       T01008                                 

Gene name
PRSS2, TRYP8
Definition
protease, serine, 2 (trypsin 2) (EC:3.4.21.4)
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
bta  Bos taurus (cow)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:bta04080]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:bta04972]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:bta04974]
Human Diseases; Infectious diseases; Influenza A [PATH:bta05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
4
AA seq 247 aa AA seqDB search
MHPLLILAFVGAAVAFPSDDDDKIVGGYTCAENSVPYQVSLNAGYHFCGGSLINDQWVVS
AAHCYQYHIQVRLGEYNIDVLEGGEQFIDASKIIRHPKYSSWTLDNDILLIKLSTPAVIN
ARVSTLALPSACASGSTECLISGWGNTLSSGVNYPDLLQCLEAPLLSHADCEASYPGEIT
NNMICAGFLEGGKDSCQGDSGGPVACNGQLQGIVSWGYGCAQKGKPGVYTKVCNYVDWIQ
ETIAANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcatcccctgctgatccttgcctttgtgggagctgctgtggctttcccctcggacgac
gatgacaagatcgtcgggggctacacctgcgcggagaattctgtcccttaccaggtgtcc
ctgaatgctggctaccacttctgcgggggctccctcatcaatgaccagtgggtggtgtcc
gcggctcactgctaccagtaccacatccaggtgaggctgggagaatacaacattgatgtc
ttggagggtggtgagcagttcatcgatgcgtccaagatcatccgccaccccaagtacagc
agctggactctggacaatgacatcctgctgatcaaactctccacgcctgcggtcatcaat
gcccgggtgtccaccttggctctgcccagtgcctgtgcttccggcagcaccgagtgcctc
atctccggctggggcaacaccctgagcagtggcgtcaactacccggacctgctgcaatgc
ctggaggccccgctgctgagccacgccgactgtgaagcctcgtaccctggagagatcact
aacaacatgatctgcgctggcttcctggaaggaggcaaggattcctgccagggtgactct
ggcggccctgtggcttgcaacggacagctccagggcattgtgtcttggggctacggctgt
gcccagaagggcaagcctggggtctacaccaaggtctgcaactacgtggactggattcag
gagaccatcgccgccaacagctga

DBGET integrated database retrieval system