KEGG   Bos taurus (cow): 282682Help
Entry
282682            CDS       T01008                                 

Gene name
GRK2, ADRBK1
Definition
(RefSeq) G protein-coupled receptor kinase 2
  KO
K00910  
beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
bta  Bos taurus (cow)
Pathway
Chemokine signaling pathway
Endocytosis
Hedgehog signaling pathway
Glutamatergic synapse
Olfactory transduction
Morphine addiction
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04340 Hedgehog signaling pathway
    282682 (GRK2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    282682 (GRK2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    282682 (GRK2)
  Nervous system
   04724 Glutamatergic synapse
    282682 (GRK2)
  Sensory system
   04740 Olfactory transduction
    282682 (GRK2)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    282682 (GRK2)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     282682 (GRK2)
Protein kinases [BR:bta01001]
 Serine/threonine protein kinases: AGC group
  GRK family [OT]
   282682 (GRK2)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   282682 (GRK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
29
AA seq 689 aa AA seqDB search
MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFS
QKLGYLLFRDFCLKHLEEAKPLVEFYEEIKKYEKLETEEERLVCSREIFDTYIMKELLAC
SHPFSKSAIEHVQGHLVKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE
LRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARK
KTKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSL
LTMEEIQSVEETQIKERKCLLLKIRGGKQFVLQCDSDPELVQWKKELRDAYREAQQLVQR
VPKMKNKPRSPVVELSKVPLIQRGSANGL
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggcggacctggaggcggtgctggccgacgtgagctacctgatggccatggagaagagc
aaggccacgccggcggcgcgcgccagcaagaagatcctgctgcccgagcccagcatccgc
agcgtcatgcagaagtacctggaggaccggggcgaggtgacttttgagaagatcttctcc
cagaagctggggtacctgcttttccgagacttctgcctgaagcacctggaggaggccaag
cccttggtagagttctacgaggagatcaagaaatacgagaagctggagacagaggaggag
cgcctggtctgcagccgagagatcttcgacacgtacatcatgaaggagctgctggcctgc
tcacatcctttctcgaagagcgccattgagcacgtccagggccatctggtgaagaagcag
gtgcctccggatctcttccagccatatattgaagaaatttgccagaacctccgaggagac
gtgttccagaaattcatcgagagcgataaattcacacgattttgccagtggaagaatgta
gagctcaacatccacctgaccatgaacgacttcagtgtgcaccgcatcatcgggcgaggc
ggcttcggtgaggtctacggctgccggaaggccgacacgggcaagatgtacgccatgaag
tgtctggacaagaagcgcatcaagatgaagcaaggggagactctggccctgaatgagcgc
atcatgctgtcgctcgtcagcaccggggactgcccgttcatcgtctgcatgtcatacgcc
ttccacacaccggacaagctcagcttcatcctggatctcatgaacggcggggacctgcac
taccacctgtcccagcacggggtcttctccgaggccgacatgcgtttctacgccgccgag
atcatcctgggcctggagcacatgcacaaccgcttcgtggtctaccgggacctgaagccg
gccaacatcctgctggacgagcacggccacgtgcgcatctcagacctgggcctggcctgt
gacttctccaagaagaagcctcacgccagtgtgggcacccacgggtacatggctcccgag
gttctacagaagggtgtggcctacgacagcagcgccgactggttctccctgggctgcatg
ctcttcaagctgctgcgagggcatagccctttccggcagcacaagaccaaagacaagcat
gagatcgacagaatgacattgacaatggctgtggagctgcctgactccttctcccctgag
ctccgctccttgctggaggggctgctgcagagggatgtcaaccggaggctaggctgcctg
ggccgaggggcccaggaggtgaaggagagccccttcttccgttccctggactggcagatg
gtctttttacaaaagtaccctcccccgttgatccccccacgaggggaggtgaatgcagcc
gacgcctttgacattggctccttcgatgaggaggacacaaaaggaatcaagctactggac
agtgaccaggagctctaccgcaacttccccctgaccatctcggagcggtggcagcaggag
gtagcagagactgtctttgacaccatcaatgctgagacggaccggctggaggcccgcaag
aaaaccaaaaacaagcagttgggccacgaggaagactacgccctgggcaaggactgcatc
atgcatggctacatgtccaagatgggcaaccccttcctgacccagtggcagcggcggtac
ttctacctgttccctaaccggctcgagtggcggggcgagggcgaggccccgcagagcctg
ctgaccatggaggagatccagtcggtggaggagacgcagatcaaggagcgaaagtgcctc
ctcctcaagatccgaggtggcaagcagtttgtcctgcagtgcgatagtgacccagagctg
gtgcagtggaagaaggagcttcgagacgcctaccgcgaggcccagcagctagtgcagcgg
gtgcccaagatgaagaacaagccgcgctcgcccgtcgtggagctgagcaaggtgccactg
atccagcgcggcagtgccaacggcctctga

DBGET integrated database retrieval system