KEGG   Bos taurus (cow): 282870Help
Entry
282870            CDS       T01008                                 

Gene name
CYP1A1
Definition
(RefSeq) cytochrome P450, subfamily I (aromatic compound-inducible), polypeptide 1
  KO
K07408  cytochrome P450 family 1 subfamily A polypeptide 1 [EC:1.14.14.1]
Organism
bta  Bos taurus (cow)
Pathway
bta00140  Steroid hormone biosynthesis
bta00380  Tryptophan metabolism
bta00830  Retinol metabolism
bta00980  Metabolism of xenobiotics by cytochrome P450
bta01100  Metabolic pathways
bta04913  Ovarian steroidogenesis
bta05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    282870 (CYP1A1)
  Amino acid metabolism
   00380 Tryptophan metabolism
    282870 (CYP1A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    282870 (CYP1A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    282870 (CYP1A1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    282870 (CYP1A1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    282870 (CYP1A1)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     282870 (CYP1A1)
Cytochrome P450 [BR:bta00199]
 Cytochrome P450, animal type
  CYP1 family
   282870 (CYP1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 282870
NCBI-ProteinID: XP_002696681
BGD-bta: BT11071
Ensembl: ENSBTAG00000001021
Position
21
AA seq 516 aa AA seqDB search
MFSVFGLPIPISATELLLASAVFCLVFWVVRTWRPRVPQGLKSPPEPWGWPLLGHMLMLG
KNPHVVLSQLSQRYGDVLQIRIGCTPVLVLSGLDTVRQALVRQGDDFKGRPDLYSFTLIT
NGQSMTFNPDSGPVWAARRRLAQNALKSFSTASDPASSSSCYLEEHVNKEAKYLLGKFQE
LMSGPGRFDPYRYIVVSVANVICAICFGRRYDHNDQEFLSLVNLSNEFGEITASGNPSDF
IPVLRYLPNTALDLFKDLNQRFYVFVQKIVKEHYKTFEKGHIRDITDSLIEHCQDKRLDE
NANIQLSDEKIINVVIDLFGAGFDTVTTALSWSLLYLVTSPRVQKKIQEELDTVIGRARR
PRLSDRPQLPYLEAFILETFRHSSFVPFTIPHSTTRDSNLNGFYIPKGRCVFVNQWQINH
DQKLWEDPSEFRPERFLTADGTINKVLSEKVIIFGLGKRKCIGETIARLEVFLFLAILLH
QVEFCVTPGVKVDMTPVYGLTMKYARCEHFQAHMRS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttttctgtgtttggactccccatccccatctcggccacagaacttctcctggcctct
gccgtcttctgcctggtattctgggtggtcaggacctggcggcctcgggtccctcaaggc
ctgaagagtcccccggagccctggggctggcccctgctcgggcacatgctgatgttgggg
aagaacccacacgtggtcctgtcgcagctgagccagcgctatggggacgtgctgcagatc
cgcattggctgcacacccgtgctggtgctcagcggcctggacaccgtccggcaggccctc
gtgcggcagggcgatgatttcaagggccggcccgacctctacagcttcaccttgatcact
aacggccagagcatgaccttcaacccagactctggaccggtgtgggctgcccgacgacgc
ctggcccagaatgctctgaagagtttctccactgcctcagacccggcatcctcatcctct
tgctatctggaagagcatgtgaacaaggaggccaagtacctcctgggcaagttccaagag
ctgatgtcagggcctgggcgctttgacccctacaggtatatagtggtgtcagtggccaat
gtcatctgtgccatatgctttggccggcgctatgaccacaatgaccaagagtttcttagc
ctcgtcaacctgagtaatgagtttggggagataactgcctccgggaacccatctgacttc
atccctgtcctccgttacctgcccaacactgccctggacctcttcaaggacctgaatcag
aggttctacgtctttgtacagaagatagtcaaggaacactataaaacgtttgagaagggt
cacatccgggacatcacagacagcctgattgagcactgtcaggacaagaggctggacgag
aatgccaatatccagctgtcggatgagaagatcattaatgttgtcatagacctctttgga
gccgggtttgacacagtcacaactgccctttcctggagcctcctgtacctggtgacaagc
cccagggtgcaaaaaaagattcaggaggagctggacacagtgattggcagggcgcggcgg
ccccggctctctgacagaccccagctgccctatttggaggcctttatcctggagaccttc
cgacactcctcctttgtccccttcaccatcccacacagtaccacaagagacagcaatctg
aacggcttttacatccccaaggggcgctgtgtctttgtgaaccagtggcagatcaaccat
gaccagaagctctgggaggatccatctgagttccggccagaacggtttctcactgctgat
ggcaccatcaacaaagtactgagtgagaaggtgattattttcggcttgggcaagcggaag
tgcatcggtgagaccattgcccgcttggaggtctttctcttcttggccatcctgctgcat
caggtggaattctgtgtgaccccgggtgtgaaggtggacatgacccccgtgtacgggctg
accatgaagtacgcccgctgtgagcactttcaggcgcacatgcgctcttag

DBGET integrated database retrieval system