KEGG   Bos taurus (cow): 282870Help
Entry
282870            CDS       T01008                                 

Gene name
CYP1A1
Definition
cytochrome P450, subfamily I (aromatic compound-inducible), polypeptide 1
Orthology
K07408  
cytochrome P450, family 1, subfamily A, polypeptide 1 [EC:1.14.14.1]
Organism
bta  Bos taurus (cow)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Ovarian steroidogenesis
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    282870 (CYP1A1)
  Amino acid metabolism
   00380 Tryptophan metabolism
    282870 (CYP1A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    282870 (CYP1A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    282870 (CYP1A1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    282870 (CYP1A1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    282870 (CYP1A1)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     282870 (CYP1A1)
Cytochrome P450 [BR:bta00199]
 Cytochrome P450, animal type
  CYP1 family
   282870 (CYP1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
21
AA seq 516 aa AA seqDB search
MFSVFGLPIPISATELLLASAVFCLVFWVVRTWRPRVPQGLKSPPEPWGWPLLGHMLMLG
KNPHVVLSQLSQRYGDVLQIRIGCTPVLVLSGLDTVRQALVRQGDDFKGRPDLYSFTLIT
NGQSMTFNPDSGPVWAARRRLAQNALKSFSTASDPASSSSCYLEEHVNKEAKYLLGKFQE
LMSGPGRFDPYRYIVVSVANVICAICFGRRYDHNDQEFLSLVNLSNEFGEITASGNPSDF
IPVLRYLPNTALDLFKDLNQRFYVFVQKIVKEHYKTFEKGHIRDITDSLIEHCQDKRLDE
NANIQLSDEKIINVVIDLFGAGFDTVTTALSWSLLYLVTSPRVQKKIQEELDTVIGRARR
PRLSDRPQLPYLEAFILETFRHSSFVPFTIPHSTTRDSNLNGFYIPKGRCVFVNQWQINH
DQKLWEDPSEFRPERFLTADGTINKVLSEKVIIFGLGKRKCIGETIARLEVFLFLAILLH
QVEFCVTPGVKVDMTPVYGLTMKYARCEHFQAHMRS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttttctgtgtttggactccccatccccatctcggccacagaacttctcctggcctct
gccgtcttctgcctggtattctgggtggtcaggacctggcggcctcgggtccctcaaggc
ctgaagagtcccccggagccctggggctggcccctgctcgggcacatgctgatgttgggg
aagaacccacacgtggtcctgtcgcagctgagccagcgctatggggacgtgctgcagatc
cgcattggctgcacacccgtgctggtgctcagcggcctggacaccgtccggcaggccctc
gtgcggcagggcgatgatttcaagggccggcccgacctctacagcttcaccttgatcact
aacggccagagcatgaccttcaacccagactctggaccggtgtgggctgcccgacgacgc
ctggcccagaatgctctgaagagtttctccactgcctcagacccggcatcctcatcctct
tgctatctggaagagcatgtgaacaaggaggccaagtacctcctgggcaagttccaagag
ctgatgtcagggcctgggcgctttgacccctacaggtatatagtggtgtcagtggccaat
gtcatctgtgccatatgctttggccggcgctatgaccacaatgaccaagagtttcttagc
ctcgtcaacctgagtaatgagtttggggagataactgcctccgggaacccatctgacttc
atccctgtcctccgttacctgcccaacactgccctggacctcttcaaggacctgaatcag
aggttctacgtctttgtacagaagatagtcaaggaacactataaaacgtttgagaagggt
cacatccgggacatcacagacagcctgattgagcactgtcaggacaagaggctggacgag
aatgccaatatccagctgtcggatgagaagatcattaatgttgtcatagacctctttgga
gccgggtttgacacagtcacaactgccctttcctggagcctcctgtacctggtgacaagc
cccagggtgcaaaaaaagattcaggaggagctggacacagtgattggcagggcgcggcgg
ccccggctctctgacagaccccagctgccctatttggaggcctttatcctggagaccttc
cgacactcctcctttgtccccttcaccatcccacacagtaccacaagagacagcaatctg
aacggcttttacatccccaaggggcgctgtgtctttgtgaaccagtggcagatcaaccat
gaccagaagctctgggaggatccatctgagttccggccagaacggtttctcactgctgat
ggcaccatcaacaaagtactgagtgagaaggtgattattttcggcttgggcaagcggaag
tgcatcggtgagaccattgcccgcttggaggtctttctcttcttggccatcctgctgcat
caggtggaattctgtgtgaccccgggtgtgaaggtggacatgacccccgtgtacgggctg
accatgaagtacgcccgctgtgagcactttcaggcgcacatgcgctcttag

DBGET integrated database retrieval system