KEGG   Bos taurus (cow): 282873Help
Entry
282873            CDS       T01008                                 

Gene name
ACSS1, ACAS2L
Definition
acyl-CoA synthetase short-chain family member 1 (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bta  Bos taurus (cow)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    282873 (ACSS1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    282873 (ACSS1)
   00620 Pyruvate metabolism
    282873 (ACSS1)
   00640 Propanoate metabolism
    282873 (ACSS1)
Enzymes [BR:bta01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     282873 (ACSS1)
Lipid biosynthesis proteins [BR:bta01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   282873 (ACSS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
13
AA seq 675 aa AA seqDB search
MAARCLGRGVGRLLGGLRGVGVRALAAPRLWSSASASVAPPSSYQERIALAAREPAAFWG
PLARDALVWDTPYHTVSDCDFRSGRISWFLGGQLNVSVNCLDQHVQKSPESIALIWERDE
PGTEVKITYRELLETTCRLANTLKRYGVRRGDRVAIYMPVSPLAVAAMLACARIGAIHNV
IFAGFSVGSLAGRINDAQCKVVITFNQGLRGGRVVQLKKIVDEAIKVCPSVQHVLVAHRT
DNKVHMGHLDVSLEQEMAKEEPVCAPESMGSEDILFLLYTSGSTGKPKGLVHTQAGYLLY
AALTHRLVFDYRPGDIFGCVADIGWITGHSYVVYGPLCNGATSVLFESTPVYPDAGRYWE
TVQRLKINQFYGAPTAYRLLLKFEDSWVKKYDRSSLRTLGSVGEPINHEAWEWLHRVVGD
SRCTLVDTWWQTETGGICISPRPSEEGAEILPCMAMRPLFGIVPVLMDEKGNVLEGGDVS
GALCLSQAWPGMARTIYGDHQRFLDAYFETYPGYYFTGDGAYRTEEGYYEITGRMDDVIN
ISGHRLGTAEIEDAMADHPAVPETAVIGYPHDIKGEAAFAFVVLKDDVGDVDVVVKELRS
VVADKIAKYAVPDQVLVVKRLPKTRSGKVMRRLLRKIVMGRAQDLGDTTTLEDPGVITEI
LSAYQEYKDKRGGAK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcgctgcttgggccgcggcgtcgggcggctactgggcggcctccgcggggtt
ggggtgcgggcgctggcggccccccggctctggagcagcgcctccgcctccgtagcgcca
cccagctcctaccaagagcgaatcgcgcttgcagctcgcgagcccgccgccttctggggg
ccactggcgcgggacgctctcgtgtgggacaccccttaccacacggtgagcgactgcgac
ttccgcagcggcaggatcagctggttcctgggaggccagttaaacgtgtctgtcaactgc
ttggatcagcacgttcagaagtccccagagagcatcgctttgatctgggagcgagatgag
cctggaactgaagtgaagatcacctacagggagctactggagaccacgtgccgcctggcc
aacacactcaagaggtatggagtccgccgaggggaccgagtggccatctacatgcctgtc
tccccactggctgtggctgccatgctggcctgtgccaggatcggagccatccacaatgtc
atctttgctggcttcagtgtggggtccttggctgggaggatcaacgatgcccaatgcaag
gtggttattaccttcaaccaaggactccggggagggcgcgtggtgcagctgaagaagatc
gtggacgaagccataaaggtctgcccatccgtccagcatgtcctggtggctcacaggaca
gacaacaaggtccacatggggcatctggatgtttcccttgagcaggagatggccaaggag
gagccggtatgtgccccggagagcatgggcagtgaggatatactcttcctcctgtacacc
tcggggagcaccgggaagcccaaggggctcgtccacacccaggcgggttacctgctctat
gctgccctgacgcaccggcttgtgtttgactaccggccaggtgacatcttcggctgcgtg
gctgatatcggctggatcacgggacacagctatgtggtgtacgggcccctctgcaatgga
gcgaccagtgtcctttttgagagcactccggtttaccctgatgcgggtcggtactgggag
acggtgcagaggctgaagatcaatcagttctatggcgccccgacagcctaccggctgctg
ctgaagttcgaggactcctgggtgaagaagtatgaccgctcttctctgcggaccctgggc
tcagtgggagagccgatcaaccacgaggcctgggaatggctgcacagggtggtgggggac
agccggtgcacgctggtagacacctggtggcagacagaaacggggggcatctgcatctct
ccacggccctcagaggagggggcagagatcctgccctgcatggcgatgaggcccctgttt
ggcattgttcccgttctcatggatgagaagggaaatgtcctggagggcggagacgtgtct
ggggctctgtgcctgtcccaggcctggccgggcatggcccggaccatctacggagaccac
cagcgattcctggacgcctacttcgagacctaccctggctactacttcacaggagacggg
gcttacagaacagaggagggctactacgagatcactgggcgcatggacgacgttatcaac
atcagtggccaccggctggggaccgcggagattgaggacgccatggctgaccaccccgcg
gtgcccgagaccgctgtcattggctacccgcatgacatcaagggagaagctgccttcgcc
ttcgttgtgttgaaagatgatgtgggtgatgtggacgtggtggtgaaggagctccggtca
gtggtggccgacaagatcgccaagtacgcagtgcccgatcaggtcctggtagtgaagcgt
cttccaaaaactcggtctggaaaagtcatgcggaggctcctgaggaagattgtcatgggc
cgagctcaggacctgggggacaccaccaccctggaggaccctggcgtcatcacggagatc
ctgagtgcctaccaggagtacaaagacaagcggggaggtgccaagtga

DBGET integrated database retrieval system