KEGG   Bos taurus (cow): 286792Help
Entry
286792            CDS       T01008                                 

Gene name
UGT1A6
Definition
(RefSeq) UDP glucuronosyltransferase 1 family, polypeptide A6
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
bta  Bos taurus (cow)
Pathway
bta00040  Pentose and glucuronate interconversions
bta00053  Ascorbate and aldarate metabolism
bta00140  Steroid hormone biosynthesis
bta00830  Retinol metabolism
bta00860  Porphyrin and chlorophyll metabolism
bta00980  Metabolism of xenobiotics by cytochrome P450
bta00982  Drug metabolism - cytochrome P450
bta00983  Drug metabolism - other enzymes
bta01100  Metabolic pathways
bta05204  Chemical carcinogenesis
Module
bta_M00014  Glucuronate pathway (uronate pathway)
bta_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    286792 (UGT1A6)
   00053 Ascorbate and aldarate metabolism
    286792 (UGT1A6)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    286792 (UGT1A6)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    286792 (UGT1A6)
   00860 Porphyrin and chlorophyll metabolism
    286792 (UGT1A6)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    286792 (UGT1A6)
   00982 Drug metabolism - cytochrome P450
    286792 (UGT1A6)
   00983 Drug metabolism - other enzymes
    286792 (UGT1A6)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    286792 (UGT1A6)
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     286792 (UGT1A6)
Glycosyltransferases [BR:bta01003]
 Others
  Hydrophobic molecule
   286792 (UGT1A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 286792
NCBI-ProteinID: NP_777187
Ensembl: ENSBTAG00000026181
UniProt: O18736
Position
3
AA seq 529 aa AA seqDB search
MACLLWRVSVAVFFLALWGFTLGDRLLVVPQDGSHWLSMKDIVEHLSEKGHEIVVVVPEV
NLLLQESKHYTRKIHPVPFNQEELEARYRSFGKHHFSPRWLVTAPVVEYRNNMIVINMYF
LNCQSLLRHSDTLRFLRENKFDALFTDPALPCGVILAEYLNLPSVYLFRGFPCALENTFT
RTPSPLSYVPRYYTQFSDHMTFLQRVGNFLVNYLENILLYALYSKYEDLAGEVLGRQVHL
PALYRKASIWLLRYDFVFEYPRPVMPNTVLIGGSSCKKQGVLSQEFEAYVNASGEHGIVV
FSLGSMVSEIPEQKAMEIADALGKIPQTVLWRYTGTPPPNLAKNTKLVKWLPQNDLLGHP
KTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMSSEDLE
KALKAVINEKTYKENIMRLSRLHKDRPIEPLDLAVFWVEFVMRHKGASHLRPAAHDLTWY
QYHSLDVIGFLLAVTLTVIFITFKACAFAFRKCFGKKERVKKSHKSKTH
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcttgccttctttggagagtttccgtggcggttttcttcttagcactttggggcttc
accctgggggacaggctgctggtggtccctcaggatggaagccactggctcagcatgaag
gacatcgttgagcatctcagtgagaaagggcatgagatcgtggtggtggtgcctgaagtc
aacctgctcctccaagagtccaagcactacacaaggaaaatccacccagtgccgttcaac
caggaggagctggaagcccgttaccgctccttcgggaaacaccacttttctccacgctgg
ttggtgactgcccctgtggtggagtataggaacaacatgattgtcatcaatatgtacttt
ctcaactgccagagtctcctgaggcactcagacaccctgcgcttcctccgggagaacaag
ttcgacgccctgttcacagacccggccttaccttgcggggtgatcctggccgagtacctg
aacctgccctccgtgtatctcttcaggggcttcccctgtgccctggagaacactttcacc
aggactccgagccccttgtcctacgtccccaggtactacactcagttctcagaccacatg
accttcctccaaagggtgggcaatttcctggtgaactacctggagaacattctgctctac
gcgctgtattccaagtacgaagacctggcaggggaagtccttgggagacaggtgcacttg
ccggccttgtatcggaaggcctccatttggctgttaagatacgactttgtgttcgagtat
cccagaccagtcatgcccaacacggtcctcatcggagggtccagctgcaagaaacagggc
gtcctgtctcaggaatttgaagcctatgtaaatgcttctggagaacacggaattgtggtt
ttctctttgggctcaatggtctcggagattccggagcagaaagctatggaaattgctgat
gctttgggcaaaatacctcaaacagtcctgtggcgatacactgggactccaccaccaaac
cttgcgaagaacacaaagctcgtcaagtggctgccccagaacgatctgctcggtcaccca
aagactcgggcctttatcacacattccggctcccatggcatttatgaaggaatatgcaat
ggcgttcccatggtgatgatgcccttgtttggtgatcagatggacaatgcaaagcgcatg
gagacccggggagctggagtgactttgaatgtcctggaaatgagttcagaagatttagaa
aaagccttgaaagctgtcatcaatgaaaagacctataaggaaaacatcatgcgcctctcc
agacttcacaaggaccgccccatagagcctctggacctggctgtgttctgggtggagttt
gtgatgaggcacaagggggcatcccacctgcgccctgcagcccatgacctcacctggtac
cagtaccactctctggatgtgattggcttcctcctggcggtcacgctgacagtcatcttc
atcacctttaaggcctgtgccttcgccttccggaaatgctttgggaagaaagagcgagtg
aagaaatctcataaatccaagacacactga

DBGET integrated database retrieval system