KEGG   Bos taurus (cow): 286815Help
Entry
286815            CDS       T01008                                 

Gene name
GCH1
Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bta  Bos taurus (cow)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    286815 (GCH1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     286815 (GCH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
UniProt: 
Position
10
AA seq 224 aa AA seqDB search
MEKGPGRVTLTSRGARCSNGFLEGEPPRPGPSPPAEKPPRPESKSAQPADGWNGERPRSE
EDNELNLPNLAAAYSSILRSLGEDPERQGLIKTPWRAATAMQFFTKGYQETISDLLNQKL
WEQGSVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAIIEALRPAGVGVVV
EATHMCMVMRGVQKMNSRTVTSTMLGVFREDPKTREEFLSLIKS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggagaagggtccggggcgggtgacgctgacgtcgcggggcgccaggtgcagcaatggg
ttcctcgaaggggagccgccgcggcccgggccaagcccgcccgccgagaagccgccgcga
ccggagagcaagagcgcccagccggcggacggctggaatggcgagcggcctcgcagcgag
gaggacaacgagctgaacctccccaacctggcggccgcctactcgtccatcctgcgctcg
ctgggagaggaccccgagcggcaggggctgatcaagacgccctggagggcggccacggcc
atgcagttcttcaccaaaggctaccaggaaaccatctcagaccttctaaatcagaagctc
tgggagcagggttcagtccatatcggttatcttcctaacaagcaagttcttggcctcagc
aaacttgctcggattgtagaaatctacagtagaagattacaagttcaggagcgccttacg
aaacaaattgccgtagcaatcatagaggccttgcgacctgctggagtgggggtcgtggtt
gaagcaacacacatgtgcatggtaatgcgaggagtgcagaaaatgaacagcagaaccgtg
acgagcacaatgttgggggtgttccgggaggacccgaagactcgggaagagtttctgagc
ctcatcaagagctga

DBGET integrated database retrieval system