KEGG   Bos taurus (cow): 286815Help
Entry
286815            CDS       T01008                                 

Gene name
GCH1
Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bta  Bos taurus (cow)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bta00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
UniProt: 
Position
10
AA seq 224 aa AA seqDB search
MEKGPGRVTLTSRGARCSNGFLEGEPPRPGPSPPAEKPPRPESKSAQPADGWNGERPRSE
EDNELNLPNLAAAYSSILRSLGEDPERQGLIKTPWRAATAMQFFTKGYQETISDLLNQKL
WEQGSVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAIIEALRPAGVGVVV
EATHMCMVMRGVQKMNSRTVTSTMLGVFREDPKTREEFLSLIKS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggagaagggtccggggcgggtgacgctgacgtcgcggggcgccaggtgcagcaatggg
ttcctcgaaggggagccgccgcggcccgggccaagcccgcccgccgagaagccgccgcga
ccggagagcaagagcgcccagccggcggacggctggaatggcgagcggcctcgcagcgag
gaggacaacgagctgaacctccccaacctggcggccgcctactcgtccatcctgcgctcg
ctgggagaggaccccgagcggcaggggctgatcaagacgccctggagggcggccacggcc
atgcagttcttcaccaaaggctaccaggaaaccatctcagaccttctaaatcagaagctc
tgggagcagggttcagtccatatcggttatcttcctaacaagcaagttcttggcctcagc
aaacttgctcggattgtagaaatctacagtagaagattacaagttcaggagcgccttacg
aaacaaattgccgtagcaatcatagaggccttgcgacctgctggagtgggggtcgtggtt
gaagcaacacacatgtgcatggtaatgcgaggagtgcagaaaatgaacagcagaaccgtg
acgagcacaatgttgggggtgttccgggaggacccgaagactcgggaagagtttctgagc
ctcatcaagagctga

DBGET integrated database retrieval system