KEGG   Bos taurus (cow): 286863Help
Entry
286863            CDS       T01008                                 

Gene name
YWHAB
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta
  KO
K16197  
14-3-3 protein beta/theta/zeta
Organism
bta  Bos taurus (cow)
Pathway
Cell cycle
Oocyte meiosis
PI3K-Akt signaling pathway
Hippo signaling pathway
Hepatitis B
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    286863 (YWHAB)
   04151 PI3K-Akt signaling pathway
    286863 (YWHAB)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    286863 (YWHAB)
   04114 Oocyte meiosis
    286863 (YWHAB)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    286863 (YWHAB)
  Infectious diseases
   05161 Hepatitis B
    286863 (YWHAB)
   05169 Epstein-Barr virus infection
    286863 (YWHAB)
DNA repair and recombination proteins [BR:bta03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    286863 (YWHAB)
Exosome [BR:bta04147]
 Exosomal proteins
  Proteins found in most exosomes
   286863 (YWHAB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
13
AA seq 246 aa AA seqDB search
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFY
LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggataaaagtgagctggtacagaaagccaagctcgccgagcaggccgagcgc
tacgatgacatggctgcggccatgaaggcggtcacagagcaggggcacgagctctccaac
gaggagagaaacctgctgtccgtcgcctacaagaatgtggtcggcgcccgccgttcgtcc
tggcgtgtcatctccagcatcgaacagaaaactgagaggaacgagaagaagcagcagatg
ggcaaagagtaccgcgagaagatcgaggccgagctgcaggacatctgcaatgacgtgctg
gagctgttggataaataccttattcccaatgctacacaaccagaaagtaaggtgttctac
ttgaaaatgaaaggcgattattttagatatctttctgaggtggcttctggagacaataaa
caaaccactgtgtcgaactcccagcaggcttaccaagaagcatttgaaattagtaagaaa
gaaatgcagcctacacaccccattcgactggggctggcacttaatttctccgtcttttat
tatgagattctaaactctcctgaaaaggcttgcagcctggcaaaaacggcgtttgatgag
gcgattgctgaattggacacactgaatgaagagtcttacaaagacagcaccctgattatg
cagctgcttagggacaatctcactctgtggacgtcggaaaaccagggagacgaaggagat
gctggggagggagagaactaa

DBGET integrated database retrieval system