KEGG   Bos taurus (cow): 286877Help
Entry
286877            CDS       T01008                                 

Gene name
PRKCZ
Definition
protein kinase C, zeta (EC:2.7.11.1)
Orthology
K06069  
atypical protein kinase C [EC:2.7.11.13]
Organism
bta  Bos taurus (cow)
Pathway
Rap1 signaling pathway
Chemokine signaling pathway
Endocytosis
Hippo signaling pathway
Tight junction
Platelet activation
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    286877 (PRKCZ)
   04390 Hippo signaling pathway
    286877 (PRKCZ)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    286877 (PRKCZ)
  Cellular commiunity
   04530 Tight junction
    286877 (PRKCZ)
 Organismal Systems
  Immune system
   04611 Platelet activation
    286877 (PRKCZ)
   04062 Chemokine signaling pathway
    286877 (PRKCZ)
  Endocrine system
   04910 Insulin signaling pathway
    286877 (PRKCZ)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     286877 (PRKCZ)
Protein kinases [BR:bta01001]
 Serine/threonine protein kinases: AGC group
  PKC family [OT]
   286877 (PRKCZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
16
AA seq 594 aa AA seqDB search
MPSRTGPKMDGSGGRGRVRLKAHYSGDLLITSLDSATTFDELCAEVREMCWLHPGHPLTL
KWVDNEGDPCTVSSQMELEEAFRLSCQHKDEGLTLHVFPSIPKEPGMPCPGEDKSIYRRG
ARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCIHCKLLVHKRCYVLVPL
TCSRHMDSVMPSQEPAVDDKSDDVDLPSEESDGIAYISSTRKHDNIKDDAEDLKPVIDGM
DGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQVYAMKVVKKELVHDDEDIDWVQ
TEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAA
EICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYI
APEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIP
RFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLGKKQALPPFQPQ
ITDDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSTEESV
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcaggacgggccccaagatggacgggagcggcggccgcggccgcgtccgccta
aaggcgcactatagcggggacctcctcatcaccagcctggactccgccaccaccttcgac
gagctctgcgcagaggtgcgggagatgtgctggctgcacccgggccacccgctcaccctt
aagtgggtggacaatgaaggtgacccctgcactgtgtcctcccagatggagctggaggag
gccttccgcctgtcctgtcagcacaaggatgaagggctcacccttcacgttttccccagc
atccccaaggaaccaggcatgccctgtccgggagaagacaaatccatctaccgccgtgga
gccagaagatggcggaagctgtaccgcgccaacggccacctcttccaggccaagcgcttt
aacaggagagcgtactgcggccagtgcagcgagaggatatggggcctcgcgaggcagggc
tacaggtgcatccactgcaaactgctggttcataagcgctgctacgtgctcgtcccactg
acctgcagcaggcatatggattccgtcatgccttcccaggagcctgcagtggacgacaag
agcgacgacgtggaccttccctccgaggagagtgatggaattgcttatatttcttcaacc
cggaaacatgacaacattaaagatgatgctgaggacctcaagccagtcatcgacgggatg
gacgggatcaagatatctcaggggctcgggctgcaggacttcgacctgatcagggtcatc
gggcgcgggagctacgccaaggtcctgctggtgcggctgaagaagaacgaccaggtctac
gccatgaaggtggtaaagaaggagctggtccatgacgatgaggatattgactgggtacag
acagagaagcacgtgtttgagcaggcatccagcaaccctttcttggtcggcttacactcc
tgcttccagacaacaagtcggttgttcctggtcatcgagtacgtcaacgggggcgacctc
atgttccacatgcagaggcagaggaagctgcccgaggagcacgccaggttctatgctgct
gaaatttgtatcgcactcaacttcctacacgagagagggattatctaccgggacctgaag
ctggacaatgtcctccttgacgccgatggccacatcaagctgacggactatggcatgtgc
aaggaaggcctgggccctggtgatacaacaagcactttctgcggaaccccgaactacatc
gcccctgaaatcctgcgcggagaagagtatgggttcagcgtggactggtgggcgctgggc
gtgctgatgttcgagatgatggcaggccgctcccccttcgacatcatcactgacaacccc
gacatgaacactgaagactaccttttccaagtcatcctggagaagcccatccggatcccc
cggttcctgtccgtcaaggcctcccacgtgttgaaaggatttttaaacaaggaccccaag
gagaggcttggctgccggccgcagactggattttctgatatcaagtctcacgccttcttc
cgcagtatagactgggacctgctggggaagaagcaggccctcccgcccttccagccgcag
atcacagacgactatggcctggacaacttcgatacgcagttcaccagcgagccggtgcag
ctgacccctgacgacgaggacgtaatcaagaggatcgaccagtcagagtttgaagggttc
gagtacatcaacccactgctgctgtccactgaggagtccgtatga

DBGET integrated database retrieval system