KEGG   Bos taurus (cow): 327672Help
Entry
327672            CDS       T01008                                 

Gene name
MAPK1, ERK2
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
bta  Bos taurus (cow)
Pathway
bta01521  EGFR tyrosine kinase inhibitor resistance
bta01522  Endocrine resistance
bta01524  Platinum drug resistance
bta04010  MAPK signaling pathway
bta04012  ErbB signaling pathway
bta04014  Ras signaling pathway
bta04015  Rap1 signaling pathway
bta04022  cGMP-PKG signaling pathway
bta04024  cAMP signaling pathway
bta04062  Chemokine signaling pathway
bta04066  HIF-1 signaling pathway
bta04068  FoxO signaling pathway
bta04071  Sphingolipid signaling pathway
bta04072  Phospholipase D signaling pathway
bta04114  Oocyte meiosis
bta04140  Autophagy - animal
bta04150  mTOR signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04210  Apoptosis
bta04218  Cellular senescence
bta04261  Adrenergic signaling in cardiomyocytes
bta04270  Vascular smooth muscle contraction
bta04350  TGF-beta signaling pathway
bta04360  Axon guidance
bta04370  VEGF signaling pathway
bta04371  Apelin signaling pathway
bta04380  Osteoclast differentiation
bta04510  Focal adhesion
bta04520  Adherens junction
bta04540  Gap junction
bta04550  Signaling pathways regulating pluripotency of stem cells
bta04611  Platelet activation
bta04620  Toll-like receptor signaling pathway
bta04621  NOD-like receptor signaling pathway
bta04625  C-type lectin receptor signaling pathway
bta04650  Natural killer cell mediated cytotoxicity
bta04657  IL-17 signaling pathway
bta04658  Th1 and Th2 cell differentiation
bta04659  Th17 cell differentiation
bta04660  T cell receptor signaling pathway
bta04662  B cell receptor signaling pathway
bta04664  Fc epsilon RI signaling pathway
bta04666  Fc gamma R-mediated phagocytosis
bta04668  TNF signaling pathway
bta04713  Circadian entrainment
bta04720  Long-term potentiation
bta04722  Neurotrophin signaling pathway
bta04723  Retrograde endocannabinoid signaling
bta04724  Glutamatergic synapse
bta04725  Cholinergic synapse
bta04726  Serotonergic synapse
bta04730  Long-term depression
bta04810  Regulation of actin cytoskeleton
bta04910  Insulin signaling pathway
bta04912  GnRH signaling pathway
bta04914  Progesterone-mediated oocyte maturation
bta04915  Estrogen signaling pathway
bta04916  Melanogenesis
bta04917  Prolactin signaling pathway
bta04919  Thyroid hormone signaling pathway
bta04921  Oxytocin signaling pathway
bta04926  Relaxin signaling pathway
bta04928  Parathyroid hormone synthesis, secretion and action
bta04930  Type II diabetes mellitus
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta04934  Cushing's syndrome
bta04960  Aldosterone-regulated sodium reabsorption
bta05010  Alzheimer's disease
bta05020  Prion diseases
bta05034  Alcoholism
bta05132  Salmonella infection
bta05133  Pertussis
bta05140  Leishmaniasis
bta05142  Chagas disease (American trypanosomiasis)
bta05145  Toxoplasmosis
bta05152  Tuberculosis
bta05160  Hepatitis C
bta05161  Hepatitis B
bta05164  Influenza A
bta05165  Human papillomavirus infection
bta05167  Kaposi's sarcoma-associated herpesvirus infection
bta05200  Pathways in cancer
bta05203  Viral carcinogenesis
bta05205  Proteoglycans in cancer
bta05210  Colorectal cancer
bta05211  Renal cell carcinoma
bta05212  Pancreatic cancer
bta05213  Endometrial cancer
bta05214  Glioma
bta05215  Prostate cancer
bta05216  Thyroid cancer
bta05218  Melanoma
bta05219  Bladder cancer
bta05220  Chronic myeloid leukemia
bta05221  Acute myeloid leukemia
bta05223  Non-small cell lung cancer
bta05224  Breast cancer
bta05225  Hepatocellular carcinoma
bta05226  Gastric cancer
bta05230  Central carbon metabolism in cancer
bta05231  Choline metabolism in cancer
Module
bta_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    327672 (MAPK1)
   04015 Rap1 signaling pathway
    327672 (MAPK1)
   04010 MAPK signaling pathway
    327672 (MAPK1)
   04012 ErbB signaling pathway
    327672 (MAPK1)
   04350 TGF-beta signaling pathway
    327672 (MAPK1)
   04370 VEGF signaling pathway
    327672 (MAPK1)
   04371 Apelin signaling pathway
    327672 (MAPK1)
   04668 TNF signaling pathway
    327672 (MAPK1)
   04066 HIF-1 signaling pathway
    327672 (MAPK1)
   04068 FoxO signaling pathway
    327672 (MAPK1)
   04072 Phospholipase D signaling pathway
    327672 (MAPK1)
   04071 Sphingolipid signaling pathway
    327672 (MAPK1)
   04024 cAMP signaling pathway
    327672 (MAPK1)
   04022 cGMP - PKG signaling pathway
    327672 (MAPK1)
   04151 PI3K-Akt signaling pathway
    327672 (MAPK1)
   04150 mTOR signaling pathway
    327672 (MAPK1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    327672 (MAPK1)
  Cell growth and death
   04114 Oocyte meiosis
    327672 (MAPK1)
   04210 Apoptosis
    327672 (MAPK1)
   04218 Cellular senescence
    327672 (MAPK1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    327672 (MAPK1)
   04520 Adherens junction
    327672 (MAPK1)
   04540 Gap junction
    327672 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    327672 (MAPK1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    327672 (MAPK1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    327672 (MAPK1)
   04620 Toll-like receptor signaling pathway
    327672 (MAPK1)
   04621 NOD-like receptor signaling pathway
    327672 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    327672 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    327672 (MAPK1)
   04660 T cell receptor signaling pathway
    327672 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    327672 (MAPK1)
   04659 Th17 cell differentiation
    327672 (MAPK1)
   04657 IL-17 signaling pathway
    327672 (MAPK1)
   04662 B cell receptor signaling pathway
    327672 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    327672 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    327672 (MAPK1)
   04062 Chemokine signaling pathway
    327672 (MAPK1)
  Endocrine system
   04910 Insulin signaling pathway
    327672 (MAPK1)
   04912 GnRH signaling pathway
    327672 (MAPK1)
   04915 Estrogen signaling pathway
    327672 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    327672 (MAPK1)
   04917 Prolactin signaling pathway
    327672 (MAPK1)
   04921 Oxytocin signaling pathway
    327672 (MAPK1)
   04926 Relaxin signaling pathway
    327672 (MAPK1)
   04919 Thyroid hormone signaling pathway
    327672 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    327672 (MAPK1)
   04916 Melanogenesis
    327672 (MAPK1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    327672 (MAPK1)
   04270 Vascular smooth muscle contraction
    327672 (MAPK1)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    327672 (MAPK1)
  Nervous system
   04724 Glutamatergic synapse
    327672 (MAPK1)
   04725 Cholinergic synapse
    327672 (MAPK1)
   04726 Serotonergic synapse
    327672 (MAPK1)
   04720 Long-term potentiation
    327672 (MAPK1)
   04730 Long-term depression
    327672 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    327672 (MAPK1)
   04722 Neurotrophin signaling pathway
    327672 (MAPK1)
  Development
   04360 Axon guidance
    327672 (MAPK1)
   04380 Osteoclast differentiation
    327672 (MAPK1)
  Environmental adaptation
   04713 Circadian entrainment
    327672 (MAPK1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    327672 (MAPK1)
   05230 Central carbon metabolism in cancer
    327672 (MAPK1)
   05231 Choline metabolism in cancer
    327672 (MAPK1)
   05205 Proteoglycans in cancer
    327672 (MAPK1)
   05203 Viral carcinogenesis
    327672 (MAPK1)
   05210 Colorectal cancer
    327672 (MAPK1)
   05212 Pancreatic cancer
    327672 (MAPK1)
   05225 Hepatocellular carcinoma
    327672 (MAPK1)
   05226 Gastric cancer
    327672 (MAPK1)
   05214 Glioma
    327672 (MAPK1)
   05216 Thyroid cancer
    327672 (MAPK1)
   05221 Acute myeloid leukemia
    327672 (MAPK1)
   05220 Chronic myeloid leukemia
    327672 (MAPK1)
   05218 Melanoma
    327672 (MAPK1)
   05211 Renal cell carcinoma
    327672 (MAPK1)
   05219 Bladder cancer
    327672 (MAPK1)
   05215 Prostate cancer
    327672 (MAPK1)
   05213 Endometrial cancer
    327672 (MAPK1)
   05224 Breast cancer
    327672 (MAPK1)
   05223 Non-small cell lung cancer
    327672 (MAPK1)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    327672 (MAPK1)
   05020 Prion diseases
    327672 (MAPK1)
  Substance dependence
   05034 Alcoholism
    327672 (MAPK1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    327672 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    327672 (MAPK1)
   04934 Cushing's syndrome
    327672 (MAPK1)
  Infectious diseases
   05132 Salmonella infection
    327672 (MAPK1)
   05133 Pertussis
    327672 (MAPK1)
   05152 Tuberculosis
    327672 (MAPK1)
   05164 Influenza A
    327672 (MAPK1)
   05161 Hepatitis B
    327672 (MAPK1)
   05160 Hepatitis C
    327672 (MAPK1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    327672 (MAPK1)
   05165 Human papillomavirus infection
    327672 (MAPK1)
   05145 Toxoplasmosis
    327672 (MAPK1)
   05140 Leishmaniasis
    327672 (MAPK1)
   05142 Chagas disease (American trypanosomiasis)
    327672 (MAPK1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    327672 (MAPK1)
   01524 Platinum drug resistance
    327672 (MAPK1)
   01522 Endocrine resistance
    327672 (MAPK1)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     327672 (MAPK1)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   327672 (MAPK1)
Chromosome [BR:bta03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     327672 (MAPK1)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   327672 (MAPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase Choline_kinase FTA2 Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 327672
NCBI-ProteinID: NP_786987
Ensembl: ENSBTAG00000010312
UniProt: P46196
Position
17
AA seq 360 aa AA seqDB search
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaatctctcgtacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgacaatgtcaacaaagtccgagtcgccatcaagaaaatcagcccttttgag
caccagacgtactgccagagaacgctgagagagataaagatcttactgcgcttcagacat
gagaacatcatcggaatcaatgacattattcgagcaccgaccatcgagcagatgaaagat
gtgtatatagtacaggacctcatggaaacagatctctacaagctcttgaagacgcaacac
ctcagcaacgaccacatctgctattttctctaccagatcctcagagggttaaagtatatt
cattcagccaacgtgctgcaccgtgacctcaaaccttccaacctgctgctcaacaccacc
tgcgatctcaagatctgtgactttggcttggcccgtgttgcagatccagaccacgaccac
acagggttcttgacagagtacgtggccactcgctggtaccgggctccagaaatcatgttg
aattccaagggctacaccaagtccatcgacatctggtccgtcggctgcatcctcgcggag
atgctctccaacaggcccatcttccccgggaagcactaccttgaccagctgaaccacatt
ctgggtattcttggatccccgtcgcaggaagacctgaattgtataataaatttaaaagct
agaaactacctgctctctcttccacacaaaaataaggtgccatggaacaggctgttcccg
aacgcggactccaaagctctggatctactggacaaaatgttgacgttcaaccctcacaag
aggatcgaggtggagcaggctctggcccatccttacctggagcagtactacgacccgagc
gatgagcccgtcgccgaagcacccttcaagtttgacatggaattggatgacttgcccaag
gaaaagctcaaagaactcatttttgaagagactgctcgattccagccgggataccgatct
taa

DBGET integrated database retrieval system