KEGG   Bos taurus (cow): 3283884Help
Entry
3283884           CDS       T01008                                 

Gene name
ND3
Definition
NADH dehydrogenase subunit 3
Orthology
K03880  
NADH-ubiquinone oxidoreductase chain 3 [EC:1.6.5.3]
Organism
bta  Bos taurus (cow)
Pathway
Oxidative phosphorylation
Metabolic pathways
Parkinson's disease
Module
NADH:ubiquinone oxidoreductase, mitochondria
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:bta00190]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:bta05012]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
MT
AA seq 115 aa AA seqDB search
MNLMLALLTNFTLATLLVIIAFWLPQLNVYSEKTSPYECGFDPMGSARLPFSMKFFLVAI
TFLLFDLEIALLLPLPWASQTANLNTMLTMALFLIILLAVSLAYEWTQKGLEWTE
NT seq 346 nt NT seq  +upstreamnt  +downstreamnt
ataaatttaatactagccctcctgaccaattttacactagccaccctactcgtcatcatc
gcattctgacttccccaactaaatgtatactctgagaaaacaagcccatacgaatgtgga
tttgaccccataggatcagcccgccttcccttctctataaaattctttctggtagccatc
acattcctcttatttgacctagaaattgcactcctcctaccactgccatgagcctcacaa
acagcaaatctaaacacaatgcttaccatagccctcttcctaattatcctcctagctgta
agcctagcctatgagtgaactcaaaaaggactagaatgaaccgaat

DBGET integrated database retrieval system