KEGG   Bos taurus (cow): 3283884Help
Entry
3283884           CDS       T01008                                 

Gene name
ND3
Definition
NADH dehydrogenase subunit 3
Orthology
K03880  
NADH-ubiquinone oxidoreductase chain 3 [EC:1.6.5.3]
Organism
bta  Bos taurus (cow)
Pathway
Oxidative phosphorylation
Metabolic pathways
Parkinson's disease
Module
NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    3283884 (ND3)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    3283884 (ND3)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     3283884 (ND3)
Mitochondrial biogenesis [BR:bta03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    3283884 (ND3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
MT
AA seq 115 aa AA seqDB search
MNLMLALLTNFTLATLLVIIAFWLPQLNVYSEKTSPYECGFDPMGSARLPFSMKFFLVAI
TFLLFDLEIALLLPLPWASQTANLNTMLTMALFLIILLAVSLAYEWTQKGLEWTE
NT seq 346 nt NT seq  +upstreamnt  +downstreamnt
ataaatttaatactagccctcctgaccaattttacactagccaccctactcgtcatcatc
gcattctgacttccccaactaaatgtatactctgagaaaacaagcccatacgaatgtgga
tttgaccccataggatcagcccgccttcccttctctataaaattctttctggtagccatc
acattcctcttatttgacctagaaattgcactcctcctaccactgccatgagcctcacaa
acagcaaatctaaacacaatgcttaccatagccctcttcctaattatcctcctagctgta
agcctagcctatgagtgaactcaaaaaggactagaatgaaccgaat

DBGET integrated database retrieval system