KEGG   Bos taurus (cow): 338092Help
Entry
338092            CDS       T01008                                 

Gene name
THBS2, TMEM200A, TSP-2
Definition
thrombospondin 2
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
bta  Bos taurus (cow)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    338092 (THBS2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    338092 (THBS2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    338092 (THBS2)
  Cell communication
   04510 Focal adhesion
    338092 (THBS2)
 Human Diseases
  Infectious diseases
   05144 Malaria
    338092 (THBS2)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   338092 (THBS2)
  Exosomal proteins of colorectal cancer cells
   338092 (THBS2)
  Exosomal proteins of bladder cancer cells
   338092 (THBS2)
Heparan sulfate/heparin binding proteins [BR:bta00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  338092 (THBS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
UniProt: 
Position
9
AA seq 1170 aa AA seqDB search
MLWPLLLLALWAWPSAQAGDQDEDTAFDLFSISNINRKTIGAKQFRGPDPSVPAYRFVRF
DYIPPVSAEHLGRITEAMRRKEGFFLTASMKQDRRSRGTLLALEGPGATHRQFEIVSNGP
ADTLDLTYWVDGTQHVISLEDVGLADSQWKNVTVQVTGETYSLYVGCDLMDSFALDEPFY
EHLQTERSRMYVTKGAARESHFRGLLQNVYLVFENSVEDLLSKKGCQQSQGAETNAISEN
TETLHLSPMVTMEHVGPSAEKSPEVCEHSCEELGSMIRELSGLHVIVNQLHENLRKVSND
NQFLWELIGGPPKTRNVSACWQDGRFFAENETWVVDSCTKCTCKKFKTVCHQISCPPATC
ADPWFVEGECCPSCVHDGEEGWSPWAEWTECSATCGSGTQQRGRSCDVTSNTCLGPSIQT
RACSLGRCDHRIRQDGGWSHWSPWSSCSVTCGVGNVTRIRLCNSPVPQMGGRSCKGSGRE
TKACQGPPCPVDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQHGGKDCVGGAKEQQM
CNRKSCPIDGCLSNPCFPGAECSSFPDGSWSCGSCPGGFLGNGTHCEDLDECAVVTDVCF
ATSKAHRCVNTNPGYHCLPCPPRYKGNQPFGVGLEAARTEKQVCEPENPCKDKTHSCHRH
AECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNKNLVCATNATYHCVKDNCPL
LPNSGQEDFDKDGIGDACDDDDDNDGVSDEKDNCQLLFNPRQFDYDKDEVGDRCDNCPYV
HNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPLVH
NPDQTDVDNDLVGDQCDNNEDIDEDGHQNNQDNCPHIPNANQADHDRDGQGDACDSDDDN
DGIPDDRDNCRLVANPDQEDSDGDRRGDACKDDFDNDSIPDIDDVCPENNAISETDFRNF
QMVHLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRDD
DYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRNAL
WHTGNTEGQVRTLWHDPKNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPIYD
QTYAGGRLGLFVFSQEMVYFSDLKYECRDV
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggccactgctgctgctggccctgtgggcctggcccagcgctcaggcaggagac
caggacgaggacaccgccttcgacctcttcagcatcagcaacatcaaccgcaagaccatc
ggggccaagcagttccggggcccagaccccagcgtgcccgcctaccgcttcgtccgcttt
gactacatcccgccggtgagcgcggagcacctgggccggatcaccgaggccatgcggcgc
aaggagggcttcttcctgacggccagcatgaagcaggaccgccggtcccggggcaccctg
ctggcactggagggcccgggcgccacgcacaggcagttcgagatcgtgtccaacggcccc
gcggacaccctggacctcacctactgggtggacggcacccagcacgtcatctccctggag
gacgtgggcctggctgactcccagtggaagaacgtcactgtgcaggtgaccggagagacc
tacagcctgtacgtgggctgcgacctgatggacagcttcgcgctggacgagcccttctac
gagcacctgcagaccgagaggagccggatgtacgtgaccaagggcgcagcccgcgagagc
cacttccggggtttgctgcagaacgtctacttagtctttgaaaactctgtggaggatctt
ctgagcaagaaaggttgtcagcagagccagggagctgaaaccaatgccatcagtgagaac
acagagacgctgcacctgagccccatggtcaccatggagcacgtgggcccgagtgcagag
aagagcccagaggtgtgtgagcactcctgtgaggagctgggcagcatgatccgagagctc
tcggggctgcacgtcatcgtgaaccagctccacgagaacctgcgcaaagtgtcaaatgac
aaccagtttctgtgggagctcatcggcgggccgcccaagaccaggaacgtgtccgcctgc
tggcaggacggccggttctttgccgagaatgagacctgggtggtggacagctgtaccaag
tgcacgtgcaagaaatttaagactgtttgccaccaaatcagctgcccgcccgcgacgtgt
gcggacccctggttcgtggagggcgagtgctgcccgtcctgcgtccatgacggagaggaa
ggctggtccccgtgggcggagtggacggagtgctcagccacctgcgggtcgggcacccag
cagcggggccgctcctgtgatgtcaccagcaacacctgcctggggccgtccatccagaca
cgggcctgcagcctgggcaggtgcgaccaccgcatccggcaggacggcggctggagccac
tggtcgccgtggtcctcctgctcagtgacctgcggcgtcggcaacgtcacccgtatccgc
ctctgcaactcgccagtgccgcagatggggggccggagctgcaagggcagcggccgtgag
accaaggcctgccagggcccgccctgcccggtggatggccggtggagcccctggtccccg
tggtcggcctgcacagtcacctgtgctggagggatccgtgagcggacacgcgtctgcaac
agccccgagccccagcacgggggcaaggactgcgtggggggcgccaaggagcaacagatg
tgtaacaggaagagctgccccatagacggctgcctgtccaacccctgcttccctggagct
gagtgcagcagcttccccgacggctcctggtcctgcggctcctgcccggggggcttcctg
ggcaacggcacccactgcgaggacctggacgagtgcgccgtggtcacggacgtgtgcttc
gcaaccagcaaggcacaccgctgtgtcaacaccaaccccggctaccactgcctgccctgc
ccgccgcgctacaaggggaaccagccctttggtgtcggcctggaggcggccaggactgag
aagcaggtgtgtgagcccgagaacccctgcaaggacaagacccacagctgccaccggcac
gccgagtgcatctacctgggccacttcagcgaccccatgtacaagtgcgagtgccagacg
ggctacgcgggtgacgggctcatctgcggggaggactcagacctggatggctggcccaac
aagaacctggtgtgcgccaccaacgccacgtaccactgcgtcaaggataactgccccctc
ctgcccaactcagggcaagaagacttcgacaaggatggcatcggggacgcctgcgacgac
gacgatgacaacgacggcgtctcggacgagaaggacaactgccagcttctcttcaacccc
cgtcagttcgactacgacaaagatgaggtcggggaccggtgcgacaactgcccgtatgtt
cacaacccggcccagatcgacacggacaacaacggggagggtgacgcctgctccgtggac
atcgacggggacgatgtcttcaacgagcgagacaactgtccctacgtctacaacaccgac
cagcgggacaccgacggggacggcgtgggtgaccactgtgacaactgtccgctggtgcac
aaccccgaccagaccgacgtggacaacgacctcgtgggagaccagtgtgacaacaacgag
gacatcgacgaagacggccaccagaacaaccaggacaactgcccccacatccccaacgcc
aaccaggccgaccatgaccgcgacggccagggcgacgcctgcgactcggacgacgacaat
gatgggatccccgacgacagggacaactgccggctggtcgccaaccccgaccaggaggac
tcagatggcgaccggcgtggggacgcttgtaaagacgacttcgacaacgacagtattcct
gatattgacgacgtgtgtcccgagaacaacgccatcagcgagacagacttccggaacttc
cagatggtccacttggaccccaagggcaccactcagattgatcccaactgggtcattcgc
catcaaggcaaagagctggtgcagacagccaactccgaccctggcatcgctgttggtttc
gacgagttcgggtctgtcgacttcagcggcacgttctacgtgaacacggaccgcgacgac
gactacgcgggcttcgtcttcggctaccagtccagcagccgcttctacgtggtgatgtgg
aagcaggtgacgcagacctactgggaggaccagcccacccgggcctacggctactcgggg
gtgtccctcaaggtggtgaactccaccacgggcacgggtgagcacctgaggaacgccctg
tggcacacgggcaacacagagggacaggttcgcactctatggcacgaccccaagaatatc
ggctggaaggactacactgcctaccggtggcatctgacccacaggcctaagacaggctac
ataagagtcttagtacatgaaggaaaacaagtcatggcggactcaggacccatctatgac
caaacctacgctggtgggcggctgggtctgtttgtcttctctcaagagatggtctacttc
tcggacctcaaatatgaatgcagagatgtctaa

DBGET integrated database retrieval system