KEGG   Bos taurus (cow): 369025Help
Entry
369025            CDS       T01008                                 

Gene name
PRF1
Definition
perforin 1 (pore forming protein)
Orthology
K07818  
perforin 1
Organism
bta  Bos taurus (cow)
Pathway
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Class
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:bta04650]
Human Diseases; Immune diseases; Autoimmune thyroid disease [PATH:bta05320]
Human Diseases; Immune diseases; Allograft rejection [PATH:bta05330]
Human Diseases; Immune diseases; Graft-versus-host disease [PATH:bta05332]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:bta05416]
Human Diseases; Endocrine and metabolic diseases; Type I diabetes mellitus [PATH:bta04940]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
28
AA seq 554 aa AA seqDB search
MAARLLLLGILLLLPTPAPAPCYTAARSECQRALKFVPGSWLAGEGVDVTSLQRSGSFPV
DTQRFLRPDGTCTLCRNALQKDVLQRLPLAITDWRAHGAGCKRRVVKLEGRSTEDVAGEA
ANGIRNDWQVGLDVSPKPNANVRVTVAGSHSEDANFAAQKTHQDNYRFGMDLVECRFYSF
HLVHTPPVHPEFKRALKTLPPHFNTSTKPDYHRLISSYGTHFIRSMELGGRISALTXLRT
CELALEGLTASEVEDCLAVEAEVSISDRASASPSFKACEEKKKNHKVGTSFHQAYRERHS
NVDGGHHSTMHDLLFGSQAGPEQFSAWVASLQDSPGLVDYTLEPLHMLVESQDPRREALR
QAVSKYVTDRARWRDCNRPCPPGQHKNPKNPCQCMCPGSAATTQDCCPRQKGLAHLEVMN
FKASGLWGDWITATDAYLKVFFAGQEQRTATVWNDNNPRWMTRLDFGDVLLATGGPLRVQ
VWDADFGWDDDLLGTCDRTPKSGSHEVSCPMDHGLLKFSYQVKCLPHLTGERCLQYAPQG
LLGNPPGNRSGPVW
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccgtctgctcctccttggcatcctcctgcttctgcccacacctgcccctgcc
ccctgctacacagccgcgcgctctgagtgccagcgcgccctcaagtttgtgccaggctcc
tggctggcaggggagggcgtggatgtgaccagcctccagcgctcaggctcgttcccagtg
gacacacagcgtttcctgcggcccgacggcacttgcaccctctgccgcaatgccctgcag
aaggatgtcctccagcgcctgcccctggcaatcaccgactggcgtgcccacggagcgggc
tgcaagcgcagggtggtcaagctagagggccgctccaccgaggatgtggctggggaggcg
gccaacgggatccgcaacgactggcaggtggggctggacgtgtctcccaagccaaatgct
aatgtccgtgtgacagtggcgggctcccactccgaggatgccaacttcgccgcccagaag
actcaccaggacaactaccgcttcggcatggacttagtggagtgtcgcttttacagtttt
cacctggtgcacactcccccagtacaccctgagttcaagagggccctcaagacactgccc
ccccacttcaacacctccaccaagcccgactaccacaggctcatctccagctacggaacc
cacttcatccggtccatggagctgggcggncgcatctcggccctcaccgncctgcgnacc
tgcgagctggccctggaggggctcacagccagcgaggtcgaggactgcctggctgtcgag
gctgaggtcagcataagcgacagggccagtgcctcgccatcgttcaaggcatgtgaggag
aagaagaagaaccacaaggtggggacctccttccaccaggcctaccgggagcgccattcc
aatgtcgatggtggccaccactcaaccatgcatgacctgctcttcgggagccaggctggg
cccgagcagttctcagcctgggtggcctcactgcaggacagccctggcctggtggactac
acgctggagcctctgcacatgcttgtggagagccaggacccgcggcgggaggccctcagg
caggccgtgagcaagtacgtgactgacagggcacgctggagggactgcaaccgcccgtgc
cccccggggcaacacaagaacccgaagaacccatgccagtgcatgtgtcctggttcagca
gccaccacccaggactgctgtccccggcagaagggactggcccacctggaggtcatgaac
ttcaaggcatcaggtctgtggggagactggatcactgccacggacgcctatctgaaggtt
tttttcgccggccaggagcagaggaccgccacagtatggaacgataacaaccccaggtgg
atgacgcggctggacttcggggatgtgctcctggccaccgggggccccctgagggtgcag
gtctgggatgcagactttggctgggacgatgaccttcttggcacttgtgaccgcacccca
aagtctggctcacatgaggtgtcatgccccatggaccacggtctcttgaaattctcctac
caggtcaaatgcttgcctcacctgacgggggagaggtgcctgcagtatgccccccaaggg
cttctggggaatcctccaggaaaccggagtgggccagtgtggtga

DBGET integrated database retrieval system