KEGG   Bos taurus (cow): 369025Help
Entry
369025            CDS       T01008                                 

Gene name
PRF1
Definition
perforin 1 (pore forming protein)
Orthology
K07818  
perforin 1
Organism
bta  Bos taurus (cow)
Pathway
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    369025 (PRF1)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    369025 (PRF1)
   05330 Allograft rejection
    369025 (PRF1)
   05332 Graft-versus-host disease
    369025 (PRF1)
  Cardiovascular diseases
   05416 Viral myocarditis
    369025 (PRF1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    369025 (PRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
28
AA seq 554 aa AA seqDB search
MAARLLLLGILLLLPTPAPAPCYTAARSECQRALKFVPGSWLAGEGVDVTSLQRSGSFPV
DTQRFLRPDGTCTLCRNALQKDVLQRLPLAITDWRAHGAGCKRRVVKLEGRSTEDVAGEA
ANGIRNDWQVGLDVSPKPNANVRVTVAGSHSEDANFAAQKTHQDNYRFGMDLVECRFYSF
HLVHTPPVHPEFKRALKTLPPHFNTSTKPDYHRLISSYGTHFIRSMELGGRISALTXLRT
CELALEGLTASEVEDCLAVEAEVSISDRASASPSFKACEEKKKNHKVGTSFHQAYRERHS
NVDGGHHSTMHDLLFGSQAGPEQFSAWVASLQDSPGLVDYTLEPLHMLVESQDPRREALR
QAVSKYVTDRARWRDCNRPCPPGQHKNPKNPCQCMCPGSAATTQDCCPRQKGLAHLEVMN
FKASGLWGDWITATDAYLKVFFAGQEQRTATVWNDNNPRWMTRLDFGDVLLATGGPLRVQ
VWDADFGWDDDLLGTCDRTPKSGSHEVSCPMDHGLLKFSYQVKCLPHLTGERCLQYAPQG
LLGNPPGNRSGPVW
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccgtctgctcctccttggcatcctcctgcttctgcccacacctgcccctgcc
ccctgctacacagccgcgcgctctgagtgccagcgcgccctcaagtttgtgccaggctcc
tggctggcaggggagggcgtggatgtgaccagcctccagcgctcaggctcgttcccagtg
gacacacagcgtttcctgcggcccgacggcacttgcaccctctgccgcaatgccctgcag
aaggatgtcctccagcgcctgcccctggcaatcaccgactggcgtgcccacggagcgggc
tgcaagcgcagggtggtcaagctagagggccgctccaccgaggatgtggctggggaggcg
gccaacgggatccgcaacgactggcaggtggggctggacgtgtctcccaagccaaatgct
aatgtccgtgtgacagtggcgggctcccactccgaggatgccaacttcgccgcccagaag
actcaccaggacaactaccgcttcggcatggacttagtggagtgtcgcttttacagtttt
cacctggtgcacactcccccagtacaccctgagttcaagagggccctcaagacactgccc
ccccacttcaacacctccaccaagcccgactaccacaggctcatctccagctacggaacc
cacttcatccggtccatggagctgggcggncgcatctcggccctcaccgncctgcgnacc
tgcgagctggccctggaggggctcacagccagcgaggtcgaggactgcctggctgtcgag
gctgaggtcagcataagcgacagggccagtgcctcgccatcgttcaaggcatgtgaggag
aagaagaagaaccacaaggtggggacctccttccaccaggcctaccgggagcgccattcc
aatgtcgatggtggccaccactcaaccatgcatgacctgctcttcgggagccaggctggg
cccgagcagttctcagcctgggtggcctcactgcaggacagccctggcctggtggactac
acgctggagcctctgcacatgcttgtggagagccaggacccgcggcgggaggccctcagg
caggccgtgagcaagtacgtgactgacagggcacgctggagggactgcaaccgcccgtgc
cccccggggcaacacaagaacccgaagaacccatgccagtgcatgtgtcctggttcagca
gccaccacccaggactgctgtccccggcagaagggactggcccacctggaggtcatgaac
ttcaaggcatcaggtctgtggggagactggatcactgccacggacgcctatctgaaggtt
tttttcgccggccaggagcagaggaccgccacagtatggaacgataacaaccccaggtgg
atgacgcggctggacttcggggatgtgctcctggccaccgggggccccctgagggtgcag
gtctgggatgcagactttggctgggacgatgaccttcttggcacttgtgaccgcacccca
aagtctggctcacatgaggtgtcatgccccatggaccacggtctcttgaaattctcctac
caggtcaaatgcttgcctcacctgacgggggagaggtgcctgcagtatgccccccaaggg
cttctggggaatcctccaggaaaccggagtgggccagtgtggtga

DBGET integrated database retrieval system