KEGG   Bos taurus (cow): 369025Help
Entry
369025            CDS       T01008                                 

Gene name
PRF1
Definition
(RefSeq) perforin 1 (pore forming protein)
  KO
K07818  
perforin 1
Organism
bta  Bos taurus (cow)
Pathway
Apoptosis
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    369025 (PRF1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    369025 (PRF1)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    369025 (PRF1)
   05330 Allograft rejection
    369025 (PRF1)
   05332 Graft-versus-host disease
    369025 (PRF1)
  Cardiovascular diseases
   05416 Viral myocarditis
    369025 (PRF1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    369025 (PRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
28
AA seq 554 aa AA seqDB search
MAARLLLLGILLLLPTPAPAPCYTAARSECQRALKFVPGSWLAGEGVDVTSLQRSGSFPV
DTQRFLRPDGTCTLCRNALQKDVLQRLPLAITDWRAHGAGCKRRVVKLEGRSTEDVAGEA
ANGIRNDWQVGLDVSPKPNANVRVTVAGSHSEDANFAAQKTHQDNYRFGMDLVECRFYSF
HLVHTPPVHPEFKRALKTLPPHFNTSTKPDYHRLISSYGTHFIRSMELGGRISALTXLRT
CELALEGLTASEVEDCLAVEAEVSISDRASASPSFKACEEKKKNHKVGTSFHQAYRERHS
NVDGGHHSTMHDLLFGSQAGPEQFSAWVASLQDSPGLVDYTLEPLHMLVESQDPRREALR
QAVSKYVTDRARWRDCNRPCPPGQHKNPKNPCQCMCPGSAATTQDCCPRQKGLAHLEVMN
FKASGLWGDWITATDAYLKVFFAGQEQRTATVWNDNNPRWMTRLDFGDVLLATGGPLRVQ
VWDADFGWDDDLLGTCDRTPKSGSHEVSCPMDHGLLKFSYQVKCLPHLTGERCLQYAPQG
LLGNPPGNRSGPVW
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccgtctgctcctccttggcatcctcctgcttctgcccacacctgcccctgcc
ccctgctacacagccgcgcgctctgagtgccagcgcgccctcaagtttgtgccaggctcc
tggctggcaggggagggcgtggatgtgaccagcctccagcgctcaggctcgttcccagtg
gacacacagcgtttcctgcggcccgacggcacttgcaccctctgccgcaatgccctgcag
aaggatgtcctccagcgcctgcccctggcaatcaccgactggcgtgcccacggagcgggc
tgcaagcgcagggtggtcaagctagagggccgctccaccgaggatgtggctggggaggcg
gccaacgggatccgcaacgactggcaggtggggctggacgtgtctcccaagccaaatgct
aatgtccgtgtgacagtggcgggctcccactccgaggatgccaacttcgccgcccagaag
actcaccaggacaactaccgcttcggcatggacttagtggagtgtcgcttttacagtttt
cacctggtgcacactcccccagtacaccctgagttcaagagggccctcaagacactgccc
ccccacttcaacacctccaccaagcccgactaccacaggctcatctccagctacggaacc
cacttcatccggtccatggagctgggcggncgcatctcggccctcaccgncctgcgnacc
tgcgagctggccctggaggggctcacagccagcgaggtcgaggactgcctggctgtcgag
gctgaggtcagcataagcgacagggccagtgcctcgccatcgttcaaggcatgtgaggag
aagaagaagaaccacaaggtggggacctccttccaccaggcctaccgggagcgccattcc
aatgtcgatggtggccaccactcaaccatgcatgacctgctcttcgggagccaggctggg
cccgagcagttctcagcctgggtggcctcactgcaggacagccctggcctggtggactac
acgctggagcctctgcacatgcttgtggagagccaggacccgcggcgggaggccctcagg
caggccgtgagcaagtacgtgactgacagggcacgctggagggactgcaaccgcccgtgc
cccccggggcaacacaagaacccgaagaacccatgccagtgcatgtgtcctggttcagca
gccaccacccaggactgctgtccccggcagaagggactggcccacctggaggtcatgaac
ttcaaggcatcaggtctgtggggagactggatcactgccacggacgcctatctgaaggtt
tttttcgccggccaggagcagaggaccgccacagtatggaacgataacaaccccaggtgg
atgacgcggctggacttcggggatgtgctcctggccaccgggggccccctgagggtgcag
gtctgggatgcagactttggctgggacgatgaccttcttggcacttgtgaccgcacccca
aagtctggctcacatgaggtgtcatgccccatggaccacggtctcttgaaattctcctac
caggtcaaatgcttgcctcacctgacgggggagaggtgcctgcagtatgccccccaaggg
cttctggggaatcctccaggaaaccggagtgggccagtgtggtga

DBGET integrated database retrieval system