KEGG   Bos taurus (cow): 378475Help
Entry
378475            CDS       T01008                                 

Gene name
IL21
Definition
interleukin 21
Orthology
K05434  
interleukin 21
Organism
bta  Bos taurus (cow)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Inflammatory bowel disease (IBD)
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:bta04630]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:bta04060]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:bta05321]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
17
AA seq 152 aa AA seqDB search
MRWPGNMERIVICLMVIFSGTVAHKSSSQGQDRLFIRLRQLIDIVDQLKNYVNDLDPEFL
PAPEDVKRHCERSAFSCFQKVQLKSANNGDNEKIINILTKQLKRKLPATNTGRRQKHEVT
CPSCDSYEKKPPKEYLERLKSLIQKMIHQHLS
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgcggtggccggggaacatggagagaatagtcatttgcctgatggtcatcttctctggg
acagtggcccataagtcaagctcccaagggcaagatcgcctctttattagactgcgtcaa
cttatagacattgttgatcagctgaaaaactatgtgaatgacttggatcctgaatttctg
ccagctccagaagatgtaaagagacactgtgagcggtcagctttttcatgttttcagaag
gttcaactaaagtcagcaaataatggagacaacgaaaagataatcaacatattaactaaa
cagctgaagaggaaactacctgccacaaatacagggagaagacagaaacatgaagtaaca
tgtccttcttgtgattcttatgagaaaaaaccacccaaggaatacctagaaagactgaaa
tcactcatccaaaagatgattcatcagcatctgtcctag

DBGET integrated database retrieval system