KEGG   Bos taurus (cow): 404073Help
Entry
404073            CDS       T01008                                 

Definition
(RefSeq) histone H2B variant PT15
  KO
K11252  
histone H2B
Organism
bta  Bos taurus (cow)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    404073
  Immune diseases
   05322 Systemic lupus erythematosus
    404073
  Substance dependence
   05034 Alcoholism
    404073
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   404073
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
20
AA seq 122 aa AA seqDB search
MARNVTKRNKRCRGHQKAIYKKKSHSSSESGLRNYSLYINRVLKEVVPQKGISSRTIDII
NTMINDMFERISTEACNLMYYRKRCTLTPEDIEKAVYLLLPEKLAKYAVAFGKEAVQRYV
RS
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggccagaaacgtcaccaagaggaacaagcgctgcagaggacaccaaaaagcaatctac
aaaaagaaatcacattccagctctgaatctggccttaggaattactcactctacataaac
agggtcctaaaagaagtggttccccagaagggcatatcatctcgcaccattgacatcata
aacaccatgatcaatgacatgtttgagcgcatttccactgaagcctgcaacctaatgtat
tacaggaaacgctgtaccctcacccctgaagacatcgagaaggcagtgtatttgctgctg
cctgagaaactggctaagtatgcagtggctttcggaaaagaagctgtccaacgatatgtc
cgctcctaa

DBGET integrated database retrieval system