KEGG   Bos taurus (cow): 404126Help
Entry
404126            CDS       T01008                                 

Gene name
HDAC1
Definition
histone deacetylase 1 (EC:3.5.1.98)
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
bta  Bos taurus (cow)
Pathway
Cell cycle
Notch signaling pathway
Thyroid hormone signaling pathway
Huntington's disease
Alcoholism
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    404126 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    404126 (HDAC1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    404126 (HDAC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    404126 (HDAC1)
   05202 Transcriptional misregulation in cancers
    404126 (HDAC1)
   05203 Viral carcinogenesis
    404126 (HDAC1)
   05220 Chronic myeloid leukemia
    404126 (HDAC1)
  Neurodegenerative diseases
   05016 Huntington's disease
    404126 (HDAC1)
  Substance dependence
   05034 Alcoholism
    404126 (HDAC1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    404126 (HDAC1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     404126 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
2
AA seq 482 aa AA seqDB search
MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKQEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagactcagggcaccaagaggaaagtctgttactattacgacggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcataat
ttactccttaactatggtctctaccggaagatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccacagtgatgactacattaaattcttacgctccatccgc
ccagataacatgtccgagtacagcaagcagatgcagagattcaacgtcggtgaggactgt
cccgtatttgatggcctgtttgagttctgtcagctgtctactggtggctctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctacac
catgcaaagaagtccgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccacggc
gatggcgtggaagaggccttctataccacagaccgagtcatgactgtgtcctttcataaa
tatggagagtacttcccaggaactggggacctacgggatattggagctggcaaaggcaag
tattatgctgttaactaccctctccgagatgggattgacgacgagtcctatgaggccatt
ttcaagccggtcatgtccaaagtaatggagatgttccagcccagtgcagttgtcttgcag
tgtggctctgactccttgtctggggatcggttaggttgcttcaatctgaccatcaaaggg
catgccaagtgtgtggaatttgtgaagagcttcaacctgcctatgctgatgctgggagga
ggtggctacaccattcgtaatgtcgcccggtgctggacatatgaaacagctgtggccctg
gacacggagatccctaatgagcttccatacaacgactacttcgaatactttggaccagat
ttcaaacttcatatcagtccttccaatatgactaaccagaacactaatgagtacctggaa
aagatcaaacagcggctgttcgagaacctaagaatgctgccccacgcgcctggggtccag
atgcaggccatccccgaggacgccattccagaggagagtggtgatgaggatgaagaagac
cctgacaagcgcatctcaatctgttcctcggacaaacgaattgcctgtgaggaagagttc
tccgactctgacgaggagggagaaggcgggcgcaagaactcttccaacttcaagaaagcc
aagagagtcaaaacagaggatgagaaagagaaagatccagaagagaagaaagaagtcaca
gaagaggagaaaaccaaggaagagaagcaagaagccaaaggggtcaaggaagaggtcaag
ttggcctga

DBGET integrated database retrieval system