KEGG   Bos taurus (cow): 404170Help
Entry
404170            CDS       T01008                                 

Gene name
PAICS
Definition
phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (EC:4.1.1.21)
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
bta  Bos taurus (cow)
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bta00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
6
AA seq 425 aa AA seqDB search
MAAVEVLKIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKI
TSCIFQLLQEAGIKTAFTKKCGETAFIAPKCEMIPIEWVCRRIATGSFLKRNPGVKEGYK
FYPPKVEMFFKDDANNDPQWSEEQLIAANFCFAGLVIGQTEVDIMSHATQAIFEILEKSW
LPQNCTLVDMKIEFGVDVITREIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPE
GLQMVKKNFEWVAERVELLLKPESQCRVIVLMGSTSDLNHCEKIKKACGNFGIPCELRVT
SAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVLSGNTAYPVISCPPLTPDWGAQ
DVWSSLRLPSGLGCSTILSPEGSAQFAAQIFGLNNHLIWARLRASVLNTWISLKQADKKI
REASL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagtcgaagtactgaagattggtaaaaaactctatgagggtaaaacaaaagaa
gtctatgaattgttggatagtccaggaaaagtcctcctgcaatccaaggaccaaataaca
gcaggaaatgcagccagaaagaatcaccttgaaggaaaagctgcaatctcaaataaaatt
accagctgtatttttcagttgttacaggaagcaggtatcaaaactgctttcaccaaaaaa
tgtggggagacagctttcattgcacctaagtgtgaaatgattccaattgaatgggtttgt
agaagaatagcaactggttcttttctcaaaagaaatcctggtgttaaggaaggatataag
ttctacccacctaaagtggagatgttttttaaggatgatgccaataatgatccacagtgg
tctgaggaacagctaattgctgcaaatttttgctttgctggacttgttataggacaaact
gaagtggatatcatgagtcatgctacgcaggctatttttgaaatactggagaaatcctgg
ttgccccagaactgtacactagttgatatgaagattgaatttggtgttgatgtaatcacc
agagaaattgttcttgctgatgttattgataatgattcctggagactctggccatcagga
gaccgaagccagcaaaaagacaaacagtcgtatcgtgatctcaaggaagtaactcctgaa
gggctacagatggtgaagaaaaattttgagtgggttgcagaaagagtagagttgcttctg
aaaccagaaagtcagtgcagggttatagtattgatgggctcaacctccgatcttaatcac
tgtgaaaaaattaagaaggcttgtggaaattttggcattccatgcgaacttagggtcacc
tctgcccataaaggaccagatgaaactctgaggattaaagctgagtatgaaggagatgga
attcctactgtatttgtggcagtggcaggcagaagcaatggtttaggaccggtgttgtct
ggtaacactgcatatccagttatcagctgtcctcctctcactccagactggggagctcag
gatgtgtggtcttctcttcgattacccagtggtcttggctgttcaaccatcctttctcca
gaaggatcagctcagtttgctgctcagatatttggattaaataaccatttgatctgggcc
cgactgcgagcaagtgtattaaacacatggatttccttgaagcaggctgacaagaaaatt
agagaggccagtttataa

DBGET integrated database retrieval system