KEGG   Bos taurus (cow): 407107Help
Entry
407107            CDS       T01008                                 

Gene name
COL4A4
Definition
(RefSeq) collagen type IV alpha 4
  KO
K06237  
collagen, type IV, alpha
Organism
bta  Bos taurus (cow)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
AGE-RAGE signaling pathway in diabetic complications
Protein digestion and absorption
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    407107 (COL4A4)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    407107 (COL4A4)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    407107 (COL4A4)
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    407107 (COL4A4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    407107 (COL4A4)
   05222 Small cell lung cancer
    407107 (COL4A4)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    407107 (COL4A4)
  Infectious diseases
   05146 Amoebiasis
    407107 (COL4A4)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   407107 (COL4A4)
Cell adhesion molecules and their ligands [BR:bta04516]
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
     407107 (COL4A4)
   VLA-2
     407107 (COL4A4)
   VLA-3
     407107 (COL4A4)
   alpha 10 beta 1
     407107 (COL4A4)
   alpha 11 beta 1
     407107 (COL4A4)
  Beta8 integrins
   alpha V beta 8
    ITGB8; integrin beta 8 [KO:K06591]
     407107 (COL4A4)
 4. Link Protein Family
  CD44; CD44 antigen [KO:K06256]
   407107 (COL4A4)
 7. Others
  APP; amyloid beta A4 protein [KO:K04520]
   407107 (COL4A4)
Glycosaminoglycan binding proteins [BR:bta00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   407107 (COL4A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
2
AA seq 1709 aa AA seqDB search
MALVRRPFKCNKLLATNSWSLILILFSVQYAYGGGKKFIGLCGGRDCSLCQCFPEKGSRV
SHVKFSMGGGRGKWEITNQRAFLGGREELCVEHRSTSALPGTDGSLMMAVRRWRRSLARN
LGAWLVRNREEPTGIPGEKGMKGDSGRPGAAGDVGDKGPTGVPGFPGLDGIPGHPGPPGS
RGRPGIDGYNGSRGDPGIPGERGALGPRGPPGLPGEKGEKGNSVFILGATKGMQGDRGDP
GPPGSPGSRGVRGPAGPVGYPGEPGLAGPPGPPGSPGLKGNPGVGVKGQMGDPGEVGQQG
SPGPTLLVQPPDSGLYKGEKGIKGMPGMTGLPGPPGPRGEPGIGRKGEKGIPGFPGPRGD
PGSYGSPGFPGLKGEPGLFGDPGSFGFLGPKGDPGDRGHPGPPGVLVTPSLPLKGPPGDP
GRPGRYGETGAVGPRGPPGAPGRPGEACPGMTGPPGPRGFPGHPGFPGAAGVPGRADSAP
GKPGNQGPTGLPGVPGLPGPPGSDAVYCTVGQPGPQGTKGKVGPPGRRGSKGEKGSSGLC
ACQPGPMGPSGPPGPPGRQGSKGDLGLPGWLGEKGSPGPPGAKGSPGPPGKPGASGLPGS
KGEKGDMVVSRVKGHKGERGPDGPPGLPGQQGQHGRDGYAGEKGDTGPPGDHEDAAPGDK
GPPGPPGPPGRAGPRGPPGLGFPGPPGDRGQPGAPGYPGNRGPDGRKGRKGDTIPCNVTY
PGRPGPPGFDGPPGPKGLPGHRGAPGLRCLDGQKGQRGKPGISERPGPPGFRGDIGEPGL
GGEKGSSPVGPPGTPGSPGVNGQKGPPGDPAIGYPGLPGKSGLPGAPGSKGLRGDAGRPG
TAGPAGMPGFPGLQGPKGREGNAGFPGIPGPPGHSCERGAPGIPGQPGLPGAPGSPGAPG
WKGQRGDMGPLGPAGMKGLPGVPGWPGADGTPGLPGVPGPTGDDGLPGLPGPKGPQGLPG
FLGFPGERGKPGQDGHPGRKGEHGEKGWPGFLGDRGLKGVKGARGPPGYEGETDIISKKG
ETGEPGPSGDGGFPGENGDKGHPGMQGRRGEPGSHGPPGFHPGEPGRNGQPGLPGPPGPP
GSPGLRGNIGFPGFPGDQGEPGSPGCPGPSGMDGTRGPKGDKGESASQFGLPGPKGEPGG
PGYPGRLGASGEQGLPGAQGPGGPPGRPGPPGLSGPTGCPGSPGGPGLQGPPGEVGDPGP
RGVLGDPGAPGLPGIKGKSEGTLTPQKVLANDAPTSSECLSCTPGTCSGVPLFSGMPVDT
SFSFLLRQHWPGLLTGSTKMMLKSFCLLVWSGVPGPPGPPGSVDLLKGEPGDCGLPGPPG
LPGPPGPPGHKGFPGCDGKHGQKGPMGFPGPQGPPGSPGPPGDKGLPGPPGRRGPLGPPG
SRGEPGPPADLDACPRIPGLPGVPGPRGPEGTMGLPGMRGPPGPGCKGEPGLDGRRGEDG
LPGSPGPPGHKGDMGEAGCPGAPGPPGPMGDPGPIGFGPGYLSGFLLVLHSQTDGEPTCP
MGMPRLWTGYSLLYLEGQERAHNQDLGLAGSCLPIFSTLPFAYCNIHQVCHYARRNDRSY
WLASTAPLPMTPLSEDEIRPYISRCAVCEAPAQAVAVHSQDQSIPPCPRAWRSLWIGYSF
LMHTGAGDQGGGQALMSPGSCLEDFRAAPFLECQGRQGTCHFFANKYSFWLTTVRPDLQF
SSAPLPDTLKESHAQRQKISRCQVCVKHS
NT seq 5130 nt NT seq  +upstreamnt  +downstreamnt
atggcactggtaaggcgtcctttcaagtgcaacaagctcttggccaccaattcctggtca
ctcatacttattttgttttctgtacaatatgcatatgggggtggaaagaagtttattggt
ctctgtggaggaagagattgctctctttgccagtgctttcctgaaaagggatctcgggtg
agtcatgtgaaatttagcatgggtggtgggaggggaaaatgggaaattactaatcaaagg
gcgtttctgggtggtcgagaagagctgtgtgtggaacaccggtcaacctctgcccttcct
ggcacagatggatccctgatgatggctgtgaggcgctggcgacgttctctagctaggaat
ttgggagcgtggcttgtgcgtaaccgggaagagcccactgggatcccaggggagaaaggg
atgaaaggtgacagtggccgtcctggagcagcaggtgacgtaggtgacaagggtccaacc
ggagttcctggatttccaggtctggatgggatacctgggcacccagggcctcctggatcc
agaggcagacctggcatagatggctacaatggctcaagaggtgatccagggattccagga
gaaagaggagctcttggcccacgagggcccccaggccttcctggagaaaaaggagaaaaa
ggaaattcagtgttcattttaggtgccactaaaggtatgcagggcgacagaggggaccca
ggacctcccggctcaccaggatcaaggggagtgagaggcccagcaggcccagtggggtac
ccaggagagcccgggttagcaggacctccaggcccccctgggagtccaggcttaaagggt
aatcctggcgtgggagtaaaggggcaaatgggagacccgggtgaggttggccaacaaggt
tctccggggcccactctgttggtgcagccacctgattctggtctctataaaggagaaaag
ggtattaaaggaatgcctggaatgactggacttcctggaccaccgggacccaggggagag
cctggtattgggagaaaaggagagaaagggattcctgggtttccaggacctcggggggac
cctggttcctatggatctccaggttttccaggattaaagggggaaccaggactgtttgga
gatcctgggtcatttggatttcttggcccaaagggagatcctggagaccgagggcaccca
ggaccaccaggggttttggtaactccatctcttccactcaaaggccctccaggggatcca
gggcgccctggccgctatggagaaacaggggctgttggaccacgtggtcctcctggtgcc
ccaggtagaccaggggaagcctgtccaggcatgacgggacctcctgggccacgaggattt
cctggtcacccaggatttccaggggcagctggggttcctggaagagctgattctgctcca
ggcaaaccaggcaaccagggaccaactgggctgcctggagtgccgggactgccgggacct
ccgggatcagatgctgtatattgtactgttgggcaacccggaccacaaggaacaaaaggc
aaagtgggtcctccaggaagacgaggctccaaaggagaaaaagggagctcagggctctgt
gcctgccagcctggtcccatgggcccatcaggccctccagggcctcctgggaggcaaggg
agtaagggagacttggggctccctgggtggcttggagaaaaaggttccccaggccctcct
ggtgccaaaggatctccagggccaccgggaaaacctggtgcctcaggactacctggcagc
aaaggagaaaaaggtgacatggttgtatcaagagtgaaaggacacaaaggagaaagaggg
cctgatgggccccctggacttccagggcagcagggacaacacggtcgagatggatatgct
ggagaaaagggggacacagggccgcctggtgatcacgaggatgcagccccaggtgataaa
gggcctcctggaccgccagggccccctggcagagcgggacctagggggcccccaggcctg
ggatttcctggccctccaggagacagagggcaaccaggagctccaggctacccaggcaac
aggggtcctgatggtcggaagggtcggaaaggtgatacaattccttgtaacgtaacatac
cctgggaggccaggccctccaggttttgatggtcctccaggtccaaagggacttccaggt
catcggggtgctcctgggctgaggtgtttggatggacagaagggtcaacgtggcaaacca
ggaatctcagaaagacctggtccacctggttttcgtggtgatataggagaaccaggtttg
ggaggtgaaaaggggtcctcgcctgttgggcccccaggcactccaggttcacctggagtg
aatggtcagaaaggacccccaggagatcctgctatcggctacccaggactcccgggaaag
agcggtcttccaggagcaccagggtccaaaggactcagaggcgatgccgggcgtccaggg
accgcagggccagctggcatgcccggatttccgggtctccaaggtcccaaaggccgagag
ggaaatgctgggtttccagggatcccaggcccacctggtcactcctgtgaaagaggtgct
ccagggataccagggcaaccggggctccctggggctccaggcagtccaggtgccccaggt
tggaaaggacagcgaggggacatgggacctctgggacctgctggaatgaagggccttcct
ggagtcccaggatggccgggggcagatggaaccccaggtcttccaggggtcccaggcccc
actggagacgatgggctacctggtcttccaggcccaaagggaccccaggggctgcctggc
ttcctgggttttccaggagagagaggaaaacctggtcaggatggacaccctggcagaaag
ggagaacatggagagaagggttggcctggcttcctgggagaccgaggattgaaaggtgtc
aaaggagcaagaggacccccgggatatgaaggagaaacggatattatttccaagaagggg
gaaactggagaacctggaccttctggggatggtggattcccaggagaaaatggtgataaa
ggtcatcctgggatgcaaggaaggagaggagagccaggaagccatggaccacctggattt
caccctggggagcccggaagaaatggacagccagggcttcctggacccccaggccctcca
ggctcacctgggctgagaggaaacattggttttccaggatttccgggtgaccagggtgag
ccaggttctccagggtgcccgggaccttcaggaatggatggtacaagaggacctaaagga
gacaaaggggaatctgcaagtcagtttggcctgcctggtccaaagggtgagccgggtggc
cctggatatccaggacgtttgggagcatctggagagcagggcttgcccggtgctcaaggt
cctggaggaccacccggaaggccaggacctcctggcttgtctggaccaacaggatgtcca
ggtagtccaggggggcctgggctgcagggacccccaggagaagtgggggatcctggacca
agaggcgtcctgggggacccaggagcaccaggtcttccaggaataaaaggtaagtcagaa
ggaaccctgacccctcagaaagttctagccaatgatgctcccacaagttcagagtgcctc
tcttgcaccccagggacatgctctggggtcccccttttttccgggatgcctgtggacacc
tccttttctttcttactcaggcagcactggcctggtctcctgaccggctctaccaaaatg
atgctcaaatctttttgcctactcgtgtggtcaggagtacccgggcctccaggaccacct
gggagtgtcgaccttctgaaaggagaaccaggagactgtggtctgccagggcctccaggt
ctcccgggcccaccaggccctccaggacacaagggcttcccaggatgtgatggaaaacat
ggccagaaaggaccaatgggattcccggggccgcaggggccacctggaagtcctgggcca
cctggagacaaaggtttacctggacctccaggcagacgagggcctttgggtcctccgggt
tccagaggtgagcctgggcccccagcagacttggatgcctgcccccgaatcccagggctt
cctggggtaccaggccccagaggaccggaaggaaccatggggcttcctggcatgagaggc
ccgccgggaccagggtgcaaaggagagcctgggctggatggcaggaggggtgaggatggc
ctcccagggtcccctgggcctccgggacataaaggtgacatgggagaagcaggctgtcca
ggagcaccaggccctcctgggcccatgggggatcctgggcccatagggtttggccctgga
tacctcagtggcttcctcctggttctccacagtcagacggatggagaacccacctgcccc
atgggcatgcccaggctctggactgggtatagtctgctatacctggaaggacaggagaga
gctcacaatcaagacctcggtctggcgggctcctgcctccccatctttagcacgctgccc
ttcgcctactgcaacatccaccaggtgtgccactatgcccggaggaacgacaggtcctac
tggctggcgagcacagcgcctctgcccatgactccgctctcggaggacgagatccgcccg
tacatcagccgctgcgcagtgtgcgaggcccccgcccaggccgtggcggtgcacagccaa
gaccagtccatccccccatgtccgcgggcctggaggagcctctggatcgggtactccttc
ctcatgcacacaggcgctggggaccaaggaggcgggcaggccctcatgtccccaggcagc
tgcctagaggatttcagagccgcaccgttcctggaatgccaaggccggcagggaacttgc
cacttttttgccaacaagtatagtttctggctgacaacagtgagacctgacttgcagttt
tcctctgcaccattaccggacaccttgaaagaaagccatgctcaacgccagaaaatcagc
aggtgccaggtctgcgtgaagcatagctaa

DBGET integrated database retrieval system