KEGG   Bos taurus (cow): 407107Help
Entry
407107            CDS       T01008                                 

Gene name
COL4A4
Definition
collagen, type IV, alpha 4
Orthology
K06237  
collagen, type IV, alpha
Organism
bta  Bos taurus (cow)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Protein digestion and absorption
Amoebiasis
Pathways in cancer
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:bta04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:bta04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:bta04510]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:bta04974]
Human Diseases; Cancers; Pathways in cancer [PATH:bta05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:bta05222]
Human Diseases; Infectious diseases; Amoebiasis [PATH:bta05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Position
2
AA seq 426 aa AA seqDB search
SFCLLVWSGVPGPPGPPGSVDLLKGEPGDCGLPGPPGLPGPPGPPGHKGFPGCDGKHGQK
GPMGFPGPQGPPGSPGPPGDKGLPGPPGRRGPLGPPGSRGEPGPPADLDACPRIPGLPGV
PGPRGPEGTMGLPGMRGPPGPGCKGEPGLDGRRGEDGLPGSPGPPGHKGDMGEAGCPGAP
GPPGPMGDPGPIGFGPGYLSGFLLVLHSQTDGEPTCPMGMPRLWTGYSLLYLEGQERAHN
QDLGLAGSCLPIFSTLPFAYCNIHQVCHYARRNDRSYWLASTAPLPMTPLSEDEIRPYIS
RCAVCEAPAQAVAVHSQDQSIPPCPRAWRSLWIGYSFLMHTGAGDQGGGQALMSPGSCLE
DFRAAPFLECQGRQGTCHFFANKYSFWLTTVRPDLQFSSAPLPDTLKESHAQRQKISRCQ
VCVKHS
NT seq 1283 nt NT seq  +upstreamnt  +downstreamnt
aatctttttgcctactcgtgtggtcaggagtacccgggcctccaggaccacctgggagtg
tcgaccttctgaaaggagaaccaggagactgtggtctgccagggcctccaggtctcccgg
gcccaccaggccctccaggacacaagggcttcccaggatgtgatggaaaacatggccaga
aaggaccaatgggattcccggggccgcaggggccacctggaagtcctgggccacctggag
acaaaggtttacctggacctccaggcagacgagggcctttgggtcctccgggttccagag
gtgagcctgggcccccagcagacttggatgcctgcccccgaatcccagggcttcctgggg
taccaggccccagaggaccggaaggaaccatggggcttcctggcatgagaggcccgccgg
gaccagggtgcaaaggagagcctgggctggatggcaggaggggtgaggatggcctcccag
ggtcccctgggcctccgggacataaaggtgacatgggagaagcaggctgtccaggagcac
caggccctcctgggcccatgggggatcctgggcccatagggtttggccctggatacctca
gtggcttcctcctggttctccacagtcagacggatggagaacccacctgccccatgggca
tgcccaggctctggactgggtatagtctgctatacctggaaggacaggagagagctcaca
atcaagacctcggtctggcgggctcctgcctccccatctttagcacgctgcccttcgcct
actgcaacatccaccaggtgtgccactatgcccggaggaacgacaggtcctactggctgg
cgagcacagcgcctctgcccatgactccgctctcggaggacgagatccgcccgtacatca
gccgctgcgcagtgtgcgaggcccccgcccaggccgtggcggtgcacagccaagaccagt
ccatccccccatgtccgcgggcctggaggagcctctggatcgggtactccttcctcatgc
acacaggcgctggggaccaaggaggcgggcaggccctcatgtccccaggcagctgcctag
aggatttcagagccgcaccgttcctggaatgccaaggccggcagggaacttgccactttt
ttgccaacaagtatagtttctggctgacaacagtgagacctgacttgcagttttcctctg
caccattaccggacaccttgaaagaaagccatgctcaacgccagaaaatcagcaggtgcc
aggtctgcgtgaagcatagctaa

DBGET integrated database retrieval system