KEGG   Bos taurus (cow): 407142Help
Entry
407142            CDS       T01008                                 

Gene name
COL2A1, CB11
Definition
collagen, type II, alpha 1
Orthology
K06236  
collagen, type I/II/III/V/XI/XXIV/XXVII, alpha
Organism
bta  Bos taurus (cow)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Platelet activation
Protein digestion and absorption
Amoebiasis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    407142 (COL2A1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    407142 (COL2A1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    407142 (COL2A1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    407142 (COL2A1)
  Digestive system
   04974 Protein digestion and absorption
    407142 (COL2A1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    407142 (COL2A1)
Heparan sulfate/heparin binding proteins [BR:bta00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  407142 (COL2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 1487 aa AA seqDB search
MIRLGAPQTLVLLTLLVAAVLRCHGQDVQKAGSCVQDGQRYNDKDVWKPEPCRICVCDTG
TVLCDDIICEDMKDCLSPETPFGECCPICSADLPTASGQPGPKGQKGEPGDIKDIVGPKG
PPGPQGPAGEQGPRGDRGDKGEKGAPGPRGRDGEPGTPGNPGPPGPPGPPGPPGLGGNFA
AQMAGGFDEKAGGAQMGVMQGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPMG
PRGPPGPPGKPGDDGEAGKPGKSGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKG
EAGAPGVKGESGSPGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVG
PAGGPGFPGAPGAKGEAGPTGARGPEGAQGPRGEPGTPGSPGPAGAAGNPGTDGIPGAKG
SAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQG
APGPAGEEGKRGARGEPGGAGPAGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAG
PKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPG
VMGFPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPG
PSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGSQGLQGARG
LPGTPGTDGPKGAAGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPG
KDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGTAGARGAPGERGETGPPGPAGFAGPPG
ADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPG
AAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGDPGLQGPAGPPGEKGEPG
DDGPSGPDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPG
PVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAG
PIGKQGDRGEAGAQGPMGPAGPAGARGMPGPQGPRGDKGETGEAGERGLKGHRGFTGLQG
LPGPPGPSGDQGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIGPPGPRGRSGETGPAG
PPGNPGPPGPPGPPGPGIDMSAFAGLGQREKGPDPLQYMRADEAAGNLRQHDAEVDATLK
SLNNQIESLRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETG
ETCVYPNPASVPKKNWWSSKSKDKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRL
LSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTVLKDGCTK
HTGKWGKTMIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCFL
NT seq 4464 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcctcggggctccccagacgctggtgctgctgacgctgctcgtcgccgctgtc
cttcggtgtcacggccaggatgtccagaaggctggcagctgtgtgcaggacgggcagagg
tataatgataaggatgtgtggaagcccgagccctgccggatctgtgtctgtgacactggg
actgtcctctgcgacgacataatctgtgaagacatgaaagactgcctcagccccgagacc
cccttcggagagtgctgccccatctgctcagctgacctccccactgccagtgggcaacca
ggaccaaagggacagaaaggagaacctggagatatcaaggacatcgtaggacccaaggga
cctcctggacctcagggacccgcaggtgaacaaggacccagaggtgatcgtggtgacaaa
ggtgaaaaaggtgctcctggacctcgtggcagagatggagagcctgggacccctggaaac
cctggcccccctggtcctcccggcccccctggcccccctggccttggtggaaactttgct
gcccagatggctggtggatttgatgagaaggctggtggcgcccagatgggagtaatgcag
ggaccaatgggccccatgggacctcggggacccccaggccctgctggtgctcccggacct
caaggatttcaaggcaaccctggtgaacctggtgaacccggtgtttctggtcccatgggc
ccccgtggtcctcctggcccccctgggaaacctggtgatgatggtgaagctggaaagcct
ggaaaatctggcgagagaggccctcctggccctcagggtgctcgtggtttcccaggaacc
ccaggccttcctggtgtcaaaggtcacagaggttacccaggtctagatggtgctaaggga
gaagctggtgctccaggtgtgaagggtgagagtggttccccaggtgagaacggttctcca
ggcccaatgggtccccgcggcttgcctggtgagagaggacggactggccctgccggcgct
gcaggtgctcgaggcaatgacggtcagccaggccctgcagggcctccgggtcctgtgggt
cctgctggcggtcctggctttcctggtgctcctggtgccaagggtgaagctggccccacc
ggtgctcgaggtcccgaaggcgcccagggtcctcgcggtgaaccgggtactcctgggtcc
cctgggccagctggtgctgctggcaaccctggaactgatggaatccctggagccaaggga
tctgctggtgcccctggcattgctggtgctcccggcttccctggaccccgtggtccaccc
ggccctcaaggtgcaactggtcctctgggcccaaaaggtcaaacgggtgagcctggtatt
gctggcttcaaaggcgaacaaggccccaagggagaaccgggccctgctggtccccaagga
gcccctggtcctgctggtgaagaagggaaaagaggtgcccgtggagaacctggtggtgct
gggcccgccggtccccctggagaaagaggcgctcctggaaaccgtggtttcccaggtcag
gatggtctggcaggtcccaagggagcccctggagagcgaggacccagtggcctcgctggt
cccaaaggcgccaacggtgaccctggccgtcccggagagcctggccttcctggagcccgg
ggtctcactggtcgccctggtgatgctggtcctcaaggcaaagttggtccttccggagcc
cctggtgaagacggtcgccctggacccccaggtcctcagggggctcgtgggcagcctggt
gtcatgggtttccctggccccaaaggtgccaatggtgagcctggcaaagctggtgagaaa
ggactgcctggtgctcctggtctgagaggtcttcctggcaaagatggtgagacaggtgct
gcaggcccccctggacccgctggaccagctggtgaacgaggcgagcagggtgctcctggg
ccatctgggttccagggacttcctggccctcccggccccccaggtgaaggtggaaaacca
ggtgaccagggtgttcctggtgaagctggagctcccggcctcgtgggtcccaggggtgaa
cgaggtttcccaggagaacgtggctcccccggttcccagggcctccagggggcccgcggt
ctccccggcactcctggcactgatggtcccaaaggcgcagctggcccagctggcccccct
ggggctcagggccctccaggtctgcagggcatgcccggtgagaggggagcagctggtatc
gccggacccaagggagacaggggtgatgttggtgagaaaggccccgagggcgcccccggg
aaggacggtggacgaggtctgactggccccattggcccccctggcccagccggagccaac
ggtgagaagggagaagttggaccccctggtcctgctggaactgctggtgctcgaggtgcc
ccgggtgaacgtggagagacaggcccccctggacctgctggattcgccggtccccctggt
gctgatggccagcctggtgccaaaggtgaacaaggagaagccggccagaaaggtgacgct
ggtgcccccggtcctcagggcccctctggagctcctgggcctcagggtcctactggtgtg
accggtcctaaaggagcccgaggtgctcaagggcccccgggagccaccggattccccgga
gcagctggccgcgtcggacccccaggctccaatggcaaccctggaccccctggtcctcct
ggtccttctggaaaagatggtcctaaaggtgctcgaggcgacagtgggccccctggccga
gctggtgaccctggcctccaaggtcctgctggaccccctggcgagaagggagagcctgga
gatgatggtccttctggtcccgatggtcctccaggtcctcagggtctggctggtcagagg
ggcatcgttggtctgcctggacagcgtggtgagcgaggattccccggcctccccggcccc
tcgggtgagcctggcaagcagggagcccctggagcatctggagaccgaggtccccctggc
cctgtgggtcctcctggcctgactggtcctgctggtgagcctggacgtgagggaagcccc
ggtgctgacggcccccctggcagagatggcgcagctggagtcaaaggtgaccgtggagag
accggtgccgtgggtgctcctggagcccctgggccccctggctctcctggccccgctggc
ccaattggcaagcagggagaccgaggagaagctggcgcacaaggtcccatgggacctgca
ggacctgctggagcccggggaatgccaggccctcaaggcccccgaggtgacaaaggagaa
actggagaggctggcgagaggggactgaagggacaccgtggcttcactggtctgcagggt
ctgcccggcccccctggtccttctggagaccagggtgcttccggtcctgcaggtccttcc
ggccccagaggtcctcctggtcccgtcggtccctctggcaaagatggtgctaacggaatc
cctggccccattggacctcctgggccccgtggacgttccggcgagactggccctgctggt
cctcctggaaaccctggaccccctggccctcctggcccccccggccctggcatcgacatg
tccgcctttgctggccttggccagagagagaaaggccccgatcctctgcagtacatgcgg
gctgacgaggcagccggcaacctgagacagcatgatgccgaggtggacgccacactcaag
tccctcaacaaccagatcgagagcctccgtagccccgagggctcccgcaagaacccagct
cgcacctgccgagacctgaaactctgccaccctgagtggaagagcggagactactggatc
gaccccaaccagggctgcaccctggatgccatgaaggttttctgcaacatggagactggc
gagacctgcgtctaccccaacccggccagcgtccccaagaagaactggtggagcagcaag
agcaaggacaagaaacacatctggtttggagaaaccatcaacggtggcttccacttcagc
tatggagatgacaacctggctcccaacaccgccaacgtccagatgaccttcctgcgcctg
ctgtccaccgagggctctcagaacatcacctaccactgcaagaacagcattgcctacctg
gacgaagctgctggcaacctcaagaaggctctgctcatccagggctccaacgacgtggag
atccgggctgagggcaacagcaggttcacatataccgttctgaaggatggctgcacgaaa
cacaccggtaagtggggcaagactatgatcgagtaccggtcacagaagacctcccgtctg
cccatcattgacattgcacccatggacataggagggcccgagcaggaattcggtgtggac
atagggcctgtctgcttcttgtaa

DBGET integrated database retrieval system