KEGG   Bos taurus (cow): 407142Help
Entry
407142            CDS       T01008                                 

Gene name
COL2A1, CB11
Definition
(RefSeq) collagen type II alpha 1
  KO
K19719  
collagen, type II, alpha
Organism
bta  Bos taurus (cow)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    407142 (COL2A1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    407142 (COL2A1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    407142 (COL2A1)
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    407142 (COL2A1)
Glycosaminoglycan binding proteins [BR:bta00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   407142 (COL2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 1487 aa AA seqDB search
MIRLGAPQTLVLLTLLVAAVLRCHGQDVQKAGSCVQDGQRYNDKDVWKPEPCRICVCDTG
TVLCDDIICEDMKDCLSPETPFGECCPICSADLPTASGQPGPKGQKGEPGDIKDIVGPKG
PPGPQGPAGEQGPRGDRGDKGEKGAPGPRGRDGEPGTPGNPGPPGPPGPPGPPGLGGNFA
AQMAGGFDEKAGGAQMGVMQGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPMG
PRGPPGPPGKPGDDGEAGKPGKSGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKG
EAGAPGVKGESGSPGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVG
PAGGPGFPGAPGAKGEAGPTGARGPEGAQGPRGEPGTPGSPGPAGAAGNPGTDGIPGAKG
SAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQG
APGPAGEEGKRGARGEPGGAGPAGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAG
PKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPG
VMGFPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPG
PSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGSQGLQGARG
LPGTPGTDGPKGAAGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPG
KDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGTAGARGAPGERGETGPPGPAGFAGPPG
ADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPG
AAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGDPGLQGPAGPPGEKGEPG
DDGPSGPDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPG
PVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAG
PIGKQGDRGEAGAQGPMGPAGPAGARGMPGPQGPRGDKGETGEAGERGLKGHRGFTGLQG
LPGPPGPSGDQGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIGPPGPRGRSGETGPAG
PPGNPGPPGPPGPPGPGIDMSAFAGLGQREKGPDPLQYMRADEAAGNLRQHDAEVDATLK
SLNNQIESLRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETG
ETCVYPNPASVPKKNWWSSKSKDKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRL
LSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTVLKDGCTK
HTGKWGKTMIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCFL
NT seq 4464 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcctcggggctccccagacgctggtgctgctgacgctgctcgtcgccgctgtc
cttcggtgtcacggccaggatgtccagaaggctggcagctgtgtgcaggacgggcagagg
tataatgataaggatgtgtggaagcccgagccctgccggatctgtgtctgtgacactggg
actgtcctctgcgacgacataatctgtgaagacatgaaagactgcctcagccccgagacc
cccttcggagagtgctgccccatctgctcagctgacctccccactgccagtgggcaacca
ggaccaaagggacagaaaggagaacctggagatatcaaggacatcgtaggacccaaggga
cctcctggacctcagggacccgcaggtgaacaaggacccagaggtgatcgtggtgacaaa
ggtgaaaaaggtgctcctggacctcgtggcagagatggagagcctgggacccctggaaac
cctggcccccctggtcctcccggcccccctggcccccctggccttggtggaaactttgct
gcccagatggctggtggatttgatgagaaggctggtggcgcccagatgggagtaatgcag
ggaccaatgggccccatgggacctcggggacccccaggccctgctggtgctcccggacct
caaggatttcaaggcaaccctggtgaacctggtgaacccggtgtttctggtcccatgggc
ccccgtggtcctcctggcccccctgggaaacctggtgatgatggtgaagctggaaagcct
ggaaaatctggcgagagaggccctcctggccctcagggtgctcgtggtttcccaggaacc
ccaggccttcctggtgtcaaaggtcacagaggttacccaggtctagatggtgctaaggga
gaagctggtgctccaggtgtgaagggtgagagtggttccccaggtgagaacggttctcca
ggcccaatgggtccccgcggcttgcctggtgagagaggacggactggccctgccggcgct
gcaggtgctcgaggcaatgacggtcagccaggccctgcagggcctccgggtcctgtgggt
cctgctggcggtcctggctttcctggtgctcctggtgccaagggtgaagctggccccacc
ggtgctcgaggtcccgaaggcgcccagggtcctcgcggtgaaccgggtactcctgggtcc
cctgggccagctggtgctgctggcaaccctggaactgatggaatccctggagccaaggga
tctgctggtgcccctggcattgctggtgctcccggcttccctggaccccgtggtccaccc
ggccctcaaggtgcaactggtcctctgggcccaaaaggtcaaacgggtgagcctggtatt
gctggcttcaaaggcgaacaaggccccaagggagaaccgggccctgctggtccccaagga
gcccctggtcctgctggtgaagaagggaaaagaggtgcccgtggagaacctggtggtgct
gggcccgccggtccccctggagaaagaggcgctcctggaaaccgtggtttcccaggtcag
gatggtctggcaggtcccaagggagcccctggagagcgaggacccagtggcctcgctggt
cccaaaggcgccaacggtgaccctggccgtcccggagagcctggccttcctggagcccgg
ggtctcactggtcgccctggtgatgctggtcctcaaggcaaagttggtccttccggagcc
cctggtgaagacggtcgccctggacccccaggtcctcagggggctcgtgggcagcctggt
gtcatgggtttccctggccccaaaggtgccaatggtgagcctggcaaagctggtgagaaa
ggactgcctggtgctcctggtctgagaggtcttcctggcaaagatggtgagacaggtgct
gcaggcccccctggacccgctggaccagctggtgaacgaggcgagcagggtgctcctggg
ccatctgggttccagggacttcctggccctcccggccccccaggtgaaggtggaaaacca
ggtgaccagggtgttcctggtgaagctggagctcccggcctcgtgggtcccaggggtgaa
cgaggtttcccaggagaacgtggctcccccggttcccagggcctccagggggcccgcggt
ctccccggcactcctggcactgatggtcccaaaggcgcagctggcccagctggcccccct
ggggctcagggccctccaggtctgcagggcatgcccggtgagaggggagcagctggtatc
gccggacccaagggagacaggggtgatgttggtgagaaaggccccgagggcgcccccggg
aaggacggtggacgaggtctgactggccccattggcccccctggcccagccggagccaac
ggtgagaagggagaagttggaccccctggtcctgctggaactgctggtgctcgaggtgcc
ccgggtgaacgtggagagacaggcccccctggacctgctggattcgccggtccccctggt
gctgatggccagcctggtgccaaaggtgaacaaggagaagccggccagaaaggtgacgct
ggtgcccccggtcctcagggcccctctggagctcctgggcctcagggtcctactggtgtg
accggtcctaaaggagcccgaggtgctcaagggcccccgggagccaccggattccccgga
gcagctggccgcgtcggacccccaggctccaatggcaaccctggaccccctggtcctcct
ggtccttctggaaaagatggtcctaaaggtgctcgaggcgacagtgggccccctggccga
gctggtgaccctggcctccaaggtcctgctggaccccctggcgagaagggagagcctgga
gatgatggtccttctggtcccgatggtcctccaggtcctcagggtctggctggtcagagg
ggcatcgttggtctgcctggacagcgtggtgagcgaggattccccggcctccccggcccc
tcgggtgagcctggcaagcagggagcccctggagcatctggagaccgaggtccccctggc
cctgtgggtcctcctggcctgactggtcctgctggtgagcctggacgtgagggaagcccc
ggtgctgacggcccccctggcagagatggcgcagctggagtcaaaggtgaccgtggagag
accggtgccgtgggtgctcctggagcccctgggccccctggctctcctggccccgctggc
ccaattggcaagcagggagaccgaggagaagctggcgcacaaggtcccatgggacctgca
ggacctgctggagcccggggaatgccaggccctcaaggcccccgaggtgacaaaggagaa
actggagaggctggcgagaggggactgaagggacaccgtggcttcactggtctgcagggt
ctgcccggcccccctggtccttctggagaccagggtgcttccggtcctgcaggtccttcc
ggccccagaggtcctcctggtcccgtcggtccctctggcaaagatggtgctaacggaatc
cctggccccattggacctcctgggccccgtggacgttccggcgagactggccctgctggt
cctcctggaaaccctggaccccctggccctcctggcccccccggccctggcatcgacatg
tccgcctttgctggccttggccagagagagaaaggccccgatcctctgcagtacatgcgg
gccgacgaggcagccggcaacctgagacagcatgatgccgaggtggacgccacactcaag
tccctcaacaaccagatcgagagcctccgtagccccgagggctcccgcaagaacccagct
cgcacctgccgagacctgaaactctgccaccctgagtggaagagcggagactactggatc
gaccccaaccagggctgcaccctggatgccatgaaggttttctgcaacatggagactggc
gagacctgcgtctaccccaacccggccagcgtccccaagaagaactggtggagcagcaag
agcaaggacaagaaacacatctggtttggagaaaccatcaacggtggcttccacttcagc
tatggagatgacaacctggctcccaacaccgccaacgtccagatgaccttcctgcgcctg
ctgtccaccgagggctctcagaacatcacctaccactgcaagaacagcattgcctacctg
gacgaagctgctggcaacctcaagaaggctctgctcatccagggctccaacgacgtggag
atccgggctgagggcaacagcaggttcacatataccgttctgaaggatggctgcacgaaa
cacaccggtaagtggggcaagactatgatcgagtaccggtcacagaagacctcccgtctg
cccatcattgacattgcacccatggacataggagggcccgagcaggaattcggtgtggac
atagggcctgtctgcttcttgtaa

DBGET integrated database retrieval system