KEGG   Bos taurus (cow): 407142Help
Entry
407142            CDS       T01008                                 

Gene name
COL2A1, CB11
Definition
collagen, type II, alpha 1
Orthology
K06236  
collagen, type I/II/III/V/XI/XXIV/XXVII, alpha
Organism
bta  Bos taurus (cow)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Protein digestion and absorption
Amoebiasis
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:bta04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:bta04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:bta04510]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:bta04974]
Human Diseases; Infectious diseases; Amoebiasis [PATH:bta05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 1487 aa AA seqDB search
MIRLGAPQTLVLLTLLVAAVLRCHGQDVQKAGSCVQDGQRYNDKDVWKPEPCRICVCDTG
TVLCDDIICEDMKDCLSPETPFGECCPICSADLPTASGQPGPKGQKGEPGDIKDIVGPKG
PPGPQGPAGEQGPRGDRGDKGEKGAPGPRGRDGEPGTPGNPGPPGPPGPPGPPGLGGNFA
AQMAGGFDEKAGGAQMGVMQGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPMG
PRGPPGPPGKPGDDGEAGKPGKSGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKG
EAGAPGVKGESGSPGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVG
PAGGPGFPGAPGAKGEAGPTGARGPEGAQGPRGEPGTPGSPGPAGAAGNPGTDGIPGAKG
SAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQG
APGPAGEEGKRGARGEPGGAGPAGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAG
PKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPG
VMGFPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPG
PSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGSQGLQGARG
LPGTPGTDGPKGAAGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPG
KDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGTAGARGAPGERGETGPPGPAGFAGPPG
ADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPG
AAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGDPGLQGPAGPPGEKGEPG
DDGPSGPDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPG
PVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAG
PIGKQGDRGEAGAQGPMGPAGPAGARGMPGPQGPRGDKGETGEAGERGLKGHRGFTGLQG
LPGPPGPSGDQGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIGPPGPRGRSGETGPAG
PPGNPGPPGPPGPPGPGIDMSAFAGLGQREKGPDPLQYMRADEAAGNLRQHDAEVDATLK
SLNNQIESLRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETG
ETCVYPNPASVPKKNWWSSKSKDKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRL
LSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTVLKDGCTK
HTGKWGKTMIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCFL
NT seq 4464 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcctcggggctccccagacgctggtgctgctgacgctgctcgtcgccgctgtc
cttcggtgtcacggccaggatgtccagaaggctggcagctgtgtgcaggacgggcagagg
tataatgataaggatgtgtggaagcccgagccctgccggatctgtgtctgtgacactggg
actgtcctctgcgacgacataatctgtgaagacatgaaagactgcctcagccccgagacc
cccttcggagagtgctgccccatctgctcagctgacctccccactgccagtgggcaacca
ggaccaaagggacagaaaggagaacctggagatatcaaggacatcgtaggacccaaggga
cctcctggacctcagggacccgcaggtgaacaaggacccagaggtgatcgtggtgacaaa
ggtgaaaaaggtgctcctggacctcgtggcagagatggagagcctgggacccctggaaac
cctggcccccctggtcctcccggcccccctggcccccctggccttggtggaaactttgct
gcccagatggctggtggatttgatgagaaggctggtggcgcccagatgggagtaatgcag
ggaccaatgggccccatgggacctcggggacccccaggccctgctggtgctcccggacct
caaggatttcaaggcaaccctggtgaacctggtgaacccggtgtttctggtcccatgggc
ccccgtggtcctcctggcccccctgggaaacctggtgatgatggtgaagctggaaagcct
ggaaaatctggcgagagaggccctcctggccctcagggtgctcgtggtttcccaggaacc
ccaggccttcctggtgtcaaaggtcacagaggttacccaggtctagatggtgctaaggga
gaagctggtgctccaggtgtgaagggtgagagtggttccccaggtgagaacggttctcca
ggcccaatgggtccccgcggcttgcctggtgagagaggacggactggccctgccggcgct
gcaggtgctcgaggcaatgacggtcagccaggccctgcagggcctccgggtcctgtgggt
cctgctggcggtcctggctttcctggtgctcctggtgccaagggtgaagctggccccacc
ggtgctcgaggtcccgaaggcgcccagggtcctcgcggtgaaccgggtactcctgggtcc
cctgggccagctggtgctgctggcaaccctggaactgatggaatccctggagccaaggga
tctgctggtgcccctggcattgctggtgctcccggcttccctggaccccgtggtccaccc
ggccctcaaggtgcaactggtcctctgggcccaaaaggtcaaacgggtgagcctggtatt
gctggcttcaaaggcgaacaaggccccaagggagaaccgggccctgctggtccccaagga
gcccctggtcctgctggtgaagaagggaaaagaggtgcccgtggagaacctggtggtgct
gggcccgccggtccccctggagaaagaggcgctcctggaaaccgtggtttcccaggtcag
gatggtctggcaggtcccaagggagcccctggagagcgaggacccagtggcctcgctggt
cccaaaggcgccaacggtgaccctggccgtcccggagagcctggccttcctggagcccgg
ggtctcactggtcgccctggtgatgctggtcctcaaggcaaagttggtccttccggagcc
cctggtgaagacggtcgccctggacccccaggtcctcagggggctcgtgggcagcctggt
gtcatgggtttccctggccccaaaggtgccaatggtgagcctggcaaagctggtgagaaa
ggactgcctggtgctcctggtctgagaggtcttcctggcaaagatggtgagacaggtgct
gcaggcccccctggacccgctggaccagctggtgaacgaggcgagcagggtgctcctggg
ccatctgggttccagggacttcctggccctcccggccccccaggtgaaggtggaaaacca
ggtgaccagggtgttcctggtgaagctggagctcccggcctcgtgggtcccaggggtgaa
cgaggtttcccaggagaacgtggctcccccggttcccagggcctccagggggcccgcggt
ctccccggcactcctggcactgatggtcccaaaggcgcagctggcccagctggcccccct
ggggctcagggccctccaggtctgcagggcatgcccggtgagaggggagcagctggtatc
gccggacccaagggagacaggggtgatgttggtgagaaaggccccgagggcgcccccggg
aaggacggtggacgaggtctgactggccccattggcccccctggcccagccggagccaac
ggtgagaagggagaagttggaccccctggtcctgctggaactgctggtgctcgaggtgcc
ccgggtgaacgtggagagacaggcccccctggacctgctggattcgccggtccccctggt
gctgatggccagcctggtgccaaaggtgaacaaggagaagccggccagaaaggtgacgct
ggtgcccccggtcctcagggcccctctggagctcctgggcctcagggtcctactggtgtg
accggtcctaaaggagcccgaggtgctcaagggcccccgggagccaccggattccccgga
gcagctggccgcgtcggacccccaggctccaatggcaaccctggaccccctggtcctcct
ggtccttctggaaaagatggtcctaaaggtgctcgaggcgacagtgggccccctggccga
gctggtgaccctggcctccaaggtcctgctggaccccctggcgagaagggagagcctgga
gatgatggtccttctggtcccgatggtcctccaggtcctcagggtctggctggtcagagg
ggcatcgttggtctgcctggacagcgtggtgagcgaggattccccggcctccccggcccc
tcgggtgagcctggcaagcagggagcccctggagcatctggagaccgaggtccccctggc
cctgtgggtcctcctggcctgactggtcctgctggtgagcctggacgtgagggaagcccc
ggtgctgacggcccccctggcagagatggcgcagctggagtcaaaggtgaccgtggagag
accggtgccgtgggtgctcctggagcccctgggccccctggctctcctggccccgctggc
ccaattggcaagcagggagaccgaggagaagctggcgcacaaggtcccatgggacctgca
ggacctgctggagcccggggaatgccaggccctcaaggcccccgaggtgacaaaggagaa
actggagaggctggcgagaggggactgaagggacaccgtggcttcactggtctgcagggt
ctgcccggcccccctggtccttctggagaccagggtgcttccggtcctgcaggtccttcc
ggccccagaggtcctcctggtcccgtcggtccctctggcaaagatggtgctaacggaatc
cctggccccattggacctcctgggccccgtggacgttccggcgagactggccctgctggt
cctcctggaaaccctggaccccctggccctcctggcccccccggccctggcatcgacatg
tccgcctttgctggccttggccagagagagaaaggccccgatcctctgcagtacatgcgg
gctgacgaggcagccggcaacctgagacagcatgatgccgaggtggacgccacactcaag
tccctcaacaaccagatcgagagcctccgtagccccgagggctcccgcaagaacccagct
cgcacctgccgagacctgaaactctgccaccctgagtggaagagcggagactactggatc
gaccccaaccagggctgcaccctggatgccatgaaggttttctgcaacatggagactggc
gagacctgcgtctaccccaacccggccagcgtccccaagaagaactggtggagcagcaag
agcaaggacaagaaacacatctggtttggagaaaccatcaacggtggcttccacttcagc
tatggagatgacaacctggctcccaacaccgccaacgtccagatgaccttcctgcgcctg
ctgtccaccgagggctctcagaacatcacctaccactgcaagaacagcattgcctacctg
gacgaagctgctggcaacctcaagaaggctctgctcatccagggctccaacgacgtggag
atccgggctgagggcaacagcaggttcacatataccgttctgaaggatggctgcacgaaa
cacaccggtaagtggggcaagactatgatcgagtaccggtcacagaagacctcccgtctg
cccatcattgacattgcacccatggacataggagggcccgagcaggaattcggtgtggac
atagggcctgtctgcttcttgtaa

DBGET integrated database retrieval system