KEGG   Bos taurus (cow): 407146Help
Entry
407146            CDS       T01008                                 

Gene name
ART4
Definition
ADP-ribosyltransferase 4 (Dombrock blood group)
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     407146 (ART4)
Cellular antigens [BR:bta04090]
 Proteins
  407146 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Position
5
AA seq 323 aa AA seqDB search
MELRGQRNALHTNKCCPLTNHCRRILLANTAASAVRIWLLRGQLLLLLLCSGLQRPTIAV
KIDFDLTPNSFDDQYRGCSQQVMEMLLQGDYFMEELESSKHYRKVWHQTHLNWLNQEKPL
PGNMTITHALAVSVYLSDDRVHLDFSRAMASAAGSPQQYKHSFRFKYLHYFLTSAIQLLR
KEIVSRKDSLCYEVQHELKGVYLRAPVGSIVRFGQFLSTSPAREQAQRFGNQTLFTMLTC
LGAPVQDFSLKKEVLVPPYELFKVVNVSYHPRGNWLQLLSNGTQSTYNCQLLKASSRKCI
PTPLVVASLSFLTSVIIFSKSGA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggagctgcgagggcaaagaaacgctctgcacacaaacaaatgctgtcccctgaccaat
cattgcagaaggattcttctggcaaatactgcagcctctgcggtgagaatctggctcctg
agggggcagcttcttctcctgctgctgtgctctggtctgcagagacccacgattgcagtt
aaaatcgactttgacttgacaccaaattcctttgatgatcagtaccgaggctgcagccaa
caagtcatggagatgctgcttcaaggggattatttcatggaagaactagaatccagtaag
cattaccgcaaggtctggcaccaaacacacttaaactggttgaaccaagaaaaacctctc
cccgggaacatgactattacacatgctctggctgtctcggtttatttatcggacgacaga
gttcacttagacttctccagagccatggccagtgctgctgggtctccgcagcagtataaa
cattcattccgtttcaaatatctacactacttcctgacctcagcaatccagctgctgagg
aaagagattgtctcgaggaaagactctctgtgttacgaggtgcagcatgagttgaagggc
gtttacttgcgagcccccgtgggttcgatcgttcgctttggccaattcctctccacctcc
ccagcaagagaacaggcacagaggtttggaaaccaaactctatttaccatgttgacctgc
ctgggggcaccagtacaagacttctctctcaagaaggaggtcttggtccctccctatgag
ctgtttaaagttgtcaatgtgagctaccatccaagaggaaattggttgcaattgctgtca
aatgggacccaaagcacatacaactgtcagctactaaaagcttccagcagaaagtgcatc
cctactcctctggttgttgcttctctctcctttttgaccagtgtcatcatcttttccaaa
agtggagcataa

DBGET integrated database retrieval system