KEGG   Bos taurus (cow): 407148Help
Entry
407148            CDS       T01008                                 

Definition
ADP-ribosyltransferase 5-like (EC:2.4.2.31)
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     407148
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
15
AA seq 241 aa AA seqDB search
MLAALLITLSCLSLHTLGSHGQGVTIQYLSLAPDTFDDDYVGCSEEMEEKAVLLLEKEMA
DHALLRESWETAQKAWEKKRPGLTLPPGFRSQHGIAIIVYTSSSNALYWELNQAVRTGGG
SWESYMKHFPFKALHFYLTRALQLLRGGGGCSREPGQVVFRGVGTIRFEPKSVGDSIRLG
QFTSSSLDETVAHGFEKKRKSCESVPIGGQADSLSKGAFSLLSWKTLLLASWGFQLLGAG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgctggcggctctgctgatcaccctcagctgcctcagcctccacaccctgggaagccat
gggcagggtgttaccatccagtacttgagcctggctccagatacattcgatgatgactat
gtgggctgctcggaggagatggaggagaaagcggtgcttctgttagagaaggagatggcc
gaccatgccctgctgcgagagtcctgggagacagcccagaaggcctgggagaaaaaacgt
ccagggctcactctgcctcctggcttcagaagccagcacggaattgccatcatagtctac
accagctcatccaacgctttgtactgggagctgaaccaggctgtgcggactggcggtggc
tcctgggagtcctacatgaagcacttccctttcaaggctctgcatttctacctgacccgg
gccctgcagctgcttcggggtggtgggggctgcagcagggaacctgggcaggtggtgttc
cgtggtgtgggcaccattcgctttgaacctaagagtgtgggggactctatccgcttgggc
cagtttacctccagttccctggatgagacagtggcccacggatttgagaagaagaggaag
agctgtgagtctgtgccaataggagggcaggcagattcactctccaagggggccttctct
ctgctgtcctggaagaccctgctcttggcctcttgggggttccagctcttaggagctggg
ctctga

DBGET integrated database retrieval system