KEGG   Bos taurus (cow): 407168Help
Entry
407168            CDS       T01008                                 

Gene name
USP37
Definition
ubiquitin specific peptidase 37 (EC:3.4.19.12)
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     407168 (USP37)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   407168 (USP37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
UniProt: 
Position
2
AA seq 981 aa AA seqDB search
MSPLKIHGPIRIRSMQTGITKWKEGSFEVVEKENKVSLVVHYNTGGIPRIFQLSHNIKNV
VLRPSGAKQSRLMLTLQDNSFLSIDKVPSKDAEEMRLFLDAVHQNRLNAAMKPSQGSGSF
GAILGSRTSQKETNRQLSYSDNQVSSKRGSLETKDDTPFRKVLGNPSRGSIKAAAGNGVT
PARTIPSLTSTSTPLRSGLLENRTEKRKRMLSSGSELNEDYPKENDSSSNNKAMTDPSRK
YLTSSREKQLSLKQSEENRTSGLLPLQSSSFYGSRTAAKDYSPGSTNLDRTNISSQTPSA
KRSLGFLPQPAPLSVKKLRCNQDYTGWNKPRVPLSSHQQQQLQGFSNLGNTCYMNAILQS
LFSLQSFANDLLKQGIPWKKIPLNALIRRFAHLLVKKDICNSETKKDLLKKVKNAISATA
ERFSGYMQNDAHEFLSQCLDQLKEDMEKLNKTWKIEPVPGEENSPDISATRVYTCPVITN
LEFEVQHSIICKVCGEIIPKREQFNDLSIDLPRRKKPLPPRSIQDSLDLFFRAEELEYSC
EKCGGKCALVRHKFNRLPRILILHLKRYSFNVALSLNNKIGQQVIIPRYLTLSSHCTENT
KPPFNLGWSAQMAVSRPLKASQMVNSCITSPSTPSKNFTFKSKTSLALSLDSDSEDELKR
SVALSHRLCEMSGSEQQQEDLEKDSKSCRIEPDKSELENSGFDGMSEEELLAAVLEISKR
EASPSLSHEDDDKPTSSPDTGFAEDDIQEMPENPDSVETEKPKTITEPDPASFTEITKDC
DENKENKTPEGSQGEVDWLQQYDMEREREEQELQQALAQSLQEQEAWEQKEDDDLKRATE
LSLQEFNNSFVDSLGSDEDSGNEDVLDMEYTEAEAEELKRNAETGNLPHSYRLISVVSHI
GSTSSSGHYISDVYDIKKQAWFTYNDLEVSKIQEASVQSDRDRSGYIFFYMHKEIFDELL
ETEKNSQALNLEVGKTTRQVS
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctctgaagatacatggccctatcagaattcgaagtatgcagactgggattaca
aaatggaaagaaggatcctttgaagttgtggaaaaagagaataaagtcagcctagtagtt
cactacaatactggagggattccaaggatatttcagctaagtcataacattaaaaatgtg
gtgcttcgacccagtggagcaaagcaaagccgcttaatgttaactctacaagataacagc
ttcttgtcaattgataaagtaccaagtaaggatgcagaggaaatgaggttgtttctagat
gcagtccatcaaaacaggcttaatgcagccatgaaaccttctcagggttctggtagtttt
ggagctattctgggcagcaggacctcacagaaggaaaccaacaggcagctttcttattca
gacaatcaggtctcttcaaaaagaggaagtttggaaactaaagatgatactccatttcga
aaagttcttggtaatccaagtagaggatcgattaaggctgcagcaggaaatggagtaact
cctgcccggacaattccctctttgacatctacatccacacctcttagatcagggttatta
gaaaataggactgaaaagagaaaaagaatgctgtcatctggctcagagttgaatgaagat
taccctaaggaaaatgattcatcatcgaacaacaaggctatgacagatccctcaagaaag
tatttaaccagcagtagagagaagcaactgagtttgaaacagtcagaagagaataggaca
tcagggcttctacctttgcagtcgtcatctttttatggtagcagaactgcagccaaggac
tattctcctggcagcactaacttagacaggactaatatttcaagccaaactccatctgcc
aaaagaagtttgggatttcttcctcagccagctcctctttctgttaaaaaactgaggtgt
aaccaggattacactggctggaacaagccaagagtgcccctttcctctcaccaacagcag
caactgcagggcttctccaatttgggaaatacctgctatatgaatgctattttgcaatct
ctattttcactccaatcatttgcaaatgacttgctcaagcaaggtatcccatggaagaaa
attccactcaatgcacttatcagacgctttgcacacttgcttgttaaaaaagatatctgt
aattcagagaccaaaaaagacttactcaagaaggttaaaaatgccatttcagctacagca
gagagattctctggttatatgcagaatgatgctcatgaatttttaagtcagtgcttagac
cagctgaaagaagatatggaaaaattaaataaaacttggaagattgaacctgttcctgga
gaagaaaattcaccagatatttcagctactagagtatacacttgccctgttattactaat
ttggagtttgaagttcagcactccatcatctgtaaagtatgtggagagattattcccaaa
agagaacagtttaatgacctctctattgaccttcctcgaaggaaaaagccactccctcct
cgttcaattcaagattcccttgatcttttctttagagcagaagaacttgagtattcctgt
gagaaatgtggtgggaaatgtgctcttgtcagacacaaatttaacaggctacccagaatc
ctcatacttcatttgaaacgatacagcttcaatgttgctctctcacttaacaacaagatt
gggcagcaagtcatcattccaagatacctgaccctctcatctcattgcactgaaaatacg
aaaccaccctttaaccttggttggagtgcacagatggcagtttctagaccattgaaagcc
tctcaaatggtgaattcctgcatcaccagcccttctacaccttcaaagaatttcaccttc
aaatccaagacctccttggctttatcccttgattcagacagtgaagatgagcttaaacgc
tctgtggcccttagccataggctttgtgaaatgtcaggcagtgaacagcagcaggaggac
ctggaaaaggattcaaaatcatgcagaatagaacctgataaatctgaattggaaaactct
ggatttgacggaatgagtgaagaggagcttctagcagctgttttagagataagtaaaaga
gaagcttcaccatctctcagtcatgaagatgatgataaaccaactagcagccctgatact
ggatttgcagaagatgatattcaagaaatgcctgaaaatccagactctgtggaaactgag
aagccgaagacaatcacagagcctgatcctgccagttttactgagataactaaagactgt
gatgaaaataaagagaataaaactccagaaggatctcaaggagaggttgattggctccag
cagtatgatatggagcgtgagagggaggaacaggagcttcagcaggcattggctcagagc
ctccaggagcaagaggcttgggaacagaaagaagatgatgacctcaaaagagctacagag
ttaagtcttcaagagtttaacaactcttttgtggattcattgggttctgatgaggattct
ggaaatgaagatgttttagatatggagtacacagaagctgaagctgaggaactgaaaaga
aatgctgagacaggaaatcttcctcattcctatcggctcatcagtgttgtcagtcacatt
ggtagcacttcgtcttcaggtcactacattagtgatgtgtacgacattaagaagcaggca
tggtttacatataatgacctagaggtatctaaaatccaagaggcttctgtgcagagtgat
cgagatcggagtggctacatcttcttttatatgcacaaggagatatttgatgagctgctg
gaaacagaaaagaactctcaggcacttaacctggaagtggggaagaccactcgtcaggtt
tcatga

DBGET integrated database retrieval system