KEGG   Bos taurus (cow): 407215Help
Entry
407215            CDS       T01008                                 

Gene name
KAT2B, PCAF
Definition
(RefSeq) lysine acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
bta  Bos taurus (cow)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    407215 (KAT2B)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    407215 (KAT2B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    407215 (KAT2B)
  Infectious diseases
   05166 HTLV-I infection
    407215 (KAT2B)
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     407215 (KAT2B)
Transcription machinery [BR:bta03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     407215 (KAT2B)
Chromosome [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    407215 (KAT2B)
   HAT complexes
    PCAF complex
     407215 (KAT2B)
    STAGA complex
     407215 (KAT2B)
    TFTC complex
     407215 (KAT2B)
    SAGA complex
     407215 (KAT2B)
    SLIK complex
     407215 (KAT2B)
    ADA-HAT complex
     407215 (KAT2B)
    HAT-A2 complex
     407215 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
1
AA seq 1079 aa AA seqDB search
MLAERGGRPQEGPWVRKIGHRQPETNPLTINPGPRAACGAVLPGPLTPPLSPRPLPNDVS
CFKQAAVLGGMMSVTRHLLCHLVQTQPLERRRALGGNSVNPLVAFRVGVLQKLRWRKLPG
SEGGGLESRDGRGASLRLRPAGTAWRGAAGRVPGSPPSPPLQPRRGLAPGGRGEGPGEER
GEPGGGAREERGGAPGGWEARGEEPGARAAGGAVPSLREQLRPRRAARAAAGGGRRADGR
GSRAPAPRAGRRPWRGARPDWRRLLRSGPACRRRAGPRRGAPLPPAPRRAPGRGGGRARA
PAGGRGGAARARPRAGRRLLGPDRREKRSCAPPPGKKLEKLGVYSACKAEESCKCNGWKN
PNPSPTPPRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFT
CVHREEDADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKF
SHLPPKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQ
FCDSLPRYETAQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSML
EEEVYSQNSPIWDQDFLSASSRTSQLGIQTVISPPPVAGTVSYNSSSASLEQQNGGSASP
SCRGASGLEANPGEKRKMNESHVLEETKKPRVMGDIPLELIHEVMSTITDPTAMLGPETN
FLSAHSARDEAARLEERRGVIEFHVVGNSLSQKPNKKVLMWLVGLQNVFSHQLPRMPKEY
ITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHL
KEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPR
IPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKP
SGRERSKEARDPDQLYSTLRSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTM
SERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCASILEKFFFSKIKEAGLIDK
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atgttggctgagcggggagggcgcccgcaggagggaccctgggtcagaaagatcggccac
agacaacccgaaacgaatcccctcaccataaacccggggccgcgagccgcgtgcggagcc
gtgctcccggggcccctcaccccgccgctctcgccccggcccctgcccaatgacgtctcc
tgcttcaagcaggcggctgtgctgggagggatgatgtcagtcaccaggcacctgctctgc
cacctggtgcagacccagcccttggagaggagacgcgcccttggtgggaacagcgtcaat
ccgcttgtggccttcagggttggtgttttacagaagctgaggtggaggaagttgcccggc
tccgagggaggtggactggagtcgagggacggacggggcgcgtctctccgcctgcgcccc
gcggggacggcttggaggggggcggccggcagggtgcccgggtctcctccctctccaccc
ctccaaccccggcggggcctcgccccgggcggccgcggggaggggccgggggaggagcgc
ggggagccgggaggaggagcgcgggaggagcggggaggagcgccgggcggctgggaggcc
cgcggggaggagcccggagcgcgggcggcgggcggcgccgtcccctccctccgcgagcag
ctgcggcctcggcgcgcggcgcgggcggcggcgggcggcgggcggcgggcggacgggcgg
gggtcccgcgctccggcgcccagagccgggcggagaccctggcgcggcgcgcgccccgac
tggcggcgcctgctgcgctccgggccggcatgtcggaggcgggcgggcccgcgccggggc
gccccgctgccccccgcgccccgcagggcccccgggcgcggcggcggccgggcgcgggct
cctgcgggcggccgcggcggggcggcgcgggcgcggccgagggccgggcggcggctgctc
ggcccggatcgccgtgagaagcgcagctgcgctccgcccccgggcaagaagctggagaaa
ctcggggtgtactccgcctgtaaggcagaggaatcttgtaaatgcaatggctggaaaaac
cccaatccttcgcccacgccccccagagccgacctgcagcagatcatcgtcagcctgacg
gagtcctgccggagctgcagccatgccctcgctgctcacgtgtcgcatctggagaacgtg
tcggaggaggagatgaacagactgctgggcatcgtgctggatgtggagtatctctttacc
tgcgtccacagggaagaagatgccgacaccaagcaggtttatttctacctgttcaagctc
ttgaggaagtctattttacaaagaggaaaacctgtggttgaaggttctttggagaagaag
cccccttttgaaaaacctagtattgaacagggtgtgaataactttgtacagtacaaattc
agtcacctgccacccaaagaaaggcaaacgatcgttgagctggcaaaaatgttcctgaac
cgtatcaactattggcatctggaggcaccatctcagcgaagactgcgctctcccaacgat
gacatctctgggtacaaggagaactacaccaggtggctgtgttactgcaacgttccccag
ttctgcgacagcctgccgcggtacgagacggcccaggtgttcgggaggacgctgctgcgc
tccgtcttcactgtgatgcggcggcagctgctggagcaggcgaggcaggagaaggacaaa
ctgccgctggagaagcggactctgatcctcacacacttcccgaagtttctgtccatgtta
gaagaagaagtttatagtcaaaactctcccatctgggatcaggattttctctcagcttct
tccagaaccagccagcttggaatccaaacagttatcagtccacctcccgtggccgggaca
gtttcctacaattcaagctccgcttcccttgaacagcagaacggagggagcgccagtccg
tcctgtcgaggcgcgtccgggcttgaggcaaacccaggagaaaagaggaaaatgaacgag
tctcatgttttggaggagaccaagaagccccgggtgatgggcgatatcccactggagtta
atccacgaggtcatgtccaccatcacagaccccaccgcgatgcttgggccagagaccaac
tttctgtcggcgcactcggccagggacgaggcggccaggcttgaggagcggaggggtgta
atcgagttccacgtggtgggcaactccctgagccagaagcccaacaagaaggtgctcatg
tggctggtagggctgcagaacgtgttctcgcaccagctgccgcgtatgcccaaggagtac
atcacccggctcgtcttcgacccgaaacacaaaacccttgctttaatcaaagatggccgt
gtcattggcggtatctgcttccggatgttcccgtcccagggcttcacagagattgttttc
tgcgctgtaacctctaacgaacaagtcaagggctatggaacacacctgatgaaccacttg
aaggaataccacataaaacacgacatcctgaacttcctcacctacgcagatgaatacgca
attggatatttcaagaagcagggtttctccaaagaaattaaaatccctaaaaccaaatat
gttggctacatcaaggattatgaaggcgccactttaatgggatgtgagctaaatccacgg
atcccatacacggagttctctgtcatcattaagaagcagaaggagatcattaaaaagctg
atagaaagaaaacaagcccagattcggaaagtctacccgggactttcctgttttaaagat
ggagttcggcagatcccgatagaaagcattcctggaattcgagagacaggctggaagccg
agtggaagagagagaagtaaagaggccagagaccccgaccagctgtacagcacgctcagg
agcatcctgcagcaggtgaagagccatcaaagcgcttggcccttcatggaacccgtgaag
agaacagaagctccgggatattatgaagttataaggttccccatggatctgaaaaccatg
agtgaacgcctcaagaataggtactacgtgtctaagaaactgttcatggcagatttacag
cgagtctttaccaattgcaaagagtacaacccccctgagagtgaatactacaaatgtgcc
agtatcctggagaaattcttcttcagtaaaattaaggaagctggattaattgacaagtga

DBGET integrated database retrieval system