KEGG   Bos taurus (cow): 407223Help
Entry
407223            CDS       T01008                                 

Gene name
HDAC2
Definition
histone deacetylase 2 (EC:3.5.1.98)
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
bta  Bos taurus (cow)
Pathway
Cell cycle
Notch signaling pathway
Thyroid hormone signaling pathway
Huntington's disease
Alcoholism
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    407223 (HDAC2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    407223 (HDAC2)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    407223 (HDAC2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    407223 (HDAC2)
   05202 Transcriptional misregulation in cancers
    407223 (HDAC2)
   05203 Viral carcinogenesis
    407223 (HDAC2)
   05220 Chronic myeloid leukemia
    407223 (HDAC2)
  Neurodegenerative diseases
   05016 Huntington's disease
    407223 (HDAC2)
  Substance dependence
   05034 Alcoholism
    407223 (HDAC2)
  Infectious diseases
   05169 Epstein-Barr virus infection
    407223 (HDAC2)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     407223 (HDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVTDHKKGAKKARIEEDKKETEDKKADVKEEDKSKDNSGEKTDTKGA
KSEQLSNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacagtcaaggaggcggcaagaagaaagtctgctactactatgatggtgatatt
ggaaattattattacggacagggtcatcccatgaaacctcataggatccgcatgacccat
aacttgctgctaaattatggcttatatagaaaaatggagatatataggccccataaagcc
actgctgaagaaatgacaaaataccacagtgatgagtacatcaaatttctacgttcaata
agaccagataacatgtctgagtatagtaagcagatgcagagatttaatgtcggagaggac
tgtccagtgtttgatggactttttgaattttgtcagctttcaactggtggctcagttgct
ggtgctgtgaaattaaacagacaacaaactgatatggctgttaactgggctggaggatta
catcatgctaagaaatcagaagcatcaggattctgttatgttaatgatattgtgcttgcc
atccttgaattactaaagtatcatcagagagtcttatatattgatattgatatccatcat
ggtgatggtgttgaggaggctttttatacaacagatcgtgtaatgactgtatcattccat
aagtatggggaatactttcctggaacaggagacttaagggatattggtgcaggaaaaggc
aaatactatgctgtcaattttccaatgagagatggtatagatgatgaatcatatggccag
atatttaagcctattatttcaaaagtgatggagatgtatcagcctagtgctgtggtgcta
cagtgtggtgcagactccctatctggtgatagacttggttgcttcaatttgacagttaaa
ggtcatgctaaatgtgtagaagttgtaaaaactttcaatttaccattactgatgcttggg
ggaggtggatacacaatccgcaacgttgctcggtgttggacatatgagactgcagttgcc
cttgattgtgagattcccaacgaattgccatataatgattattttgagtattttggaccg
gacttcaaactgcatattagtccttcaaacatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttatttgaaaatttacgcatgttgcctcatgcacctggcgtc
cagatgcaagctattccagaagatgcagttcatgaagatagtggagatgaagatggagaa
gatccagacaagagaatttctattcgagcatcagacaaacgaatagcttgtgatgaagag
ttctcagattctgaggacgaaggagaaggcggtcgtagaaatgtgactgatcataagaaa
ggagcaaaaaaagctagaatcgaagaagacaagaaggaaacggaggacaaaaaagcagat
gttaaggaggaagataaatccaaggataatagtggtgaaaaaacagataccaaaggagcc
aaatcagaacagctcagcaatccttga

DBGET integrated database retrieval system