KEGG   Bos taurus (cow): 407223Help
Entry
407223            CDS       T01008                                 

Gene name
HDAC2
Definition
histone deacetylase 2 (EC:3.5.1.98)
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
bta  Bos taurus (cow)
Pathway
Cell cycle
Notch signaling pathway
Thyroid hormone signaling pathway
Huntington's disease
Alcoholism
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Chronic myeloid leukemia
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:bta04330]
Cellular Processes; Cell growth and death; Cell cycle [PATH:bta04110]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:bta04919]
Human Diseases; Cancers; Pathways in cancer [PATH:bta05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:bta05202]
Human Diseases; Cancers; Viral carcinogenesis [PATH:bta05203]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:bta05220]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:bta05016]
Human Diseases; Substance dependence; Alcoholism [PATH:bta05034]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:bta05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVTDHKKGAKKARIEEDKKETEDKKADVKEEDKSKDNSGEKTDTKGA
KSEQLSNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacagtcaaggaggcggcaagaagaaagtctgctactactatgatggtgatatt
ggaaattattattacggacagggtcatcccatgaaacctcataggatccgcatgacccat
aacttgctgctaaattatggcttatatagaaaaatggagatatataggccccataaagcc
actgctgaagaaatgacaaaataccacagtgatgagtacatcaaatttctacgttcaata
agaccagataacatgtctgagtatagtaagcagatgcagagatttaatgtcggagaggac
tgtccagtgtttgatggactttttgaattttgtcagctttcaactggtggctcagttgct
ggtgctgtgaaattaaacagacaacaaactgatatggctgttaactgggctggaggatta
catcatgctaagaaatcagaagcatcaggattctgttatgttaatgatattgtgcttgcc
atccttgaattactaaagtatcatcagagagtcttatatattgatattgatatccatcat
ggtgatggtgttgaggaggctttttatacaacagatcgtgtaatgactgtatcattccat
aagtatggggaatactttcctggaacaggagacttaagggatattggtgcaggaaaaggc
aaatactatgctgtcaattttccaatgagagatggtatagatgatgaatcatatggccag
atatttaagcctattatttcaaaagtgatggagatgtatcagcctagtgctgtggtgcta
cagtgtggtgcagactccctatctggtgatagacttggttgcttcaatttgacagttaaa
ggtcatgctaaatgtgtagaagttgtaaaaactttcaatttaccattactgatgcttggg
ggaggtggatacacaatccgcaacgttgctcggtgttggacatatgagactgcagttgcc
cttgattgtgagattcccaacgaattgccatataatgattattttgagtattttggaccg
gacttcaaactgcatattagtccttcaaacatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttatttgaaaatttacgcatgttgcctcatgcacctggcgtc
cagatgcaagctattccagaagatgcagttcatgaagatagtggagatgaagatggagaa
gatccagacaagagaatttctattcgagcatcagacaaacgaatagcttgtgatgaagag
ttctcagattctgaggacgaaggagaaggcggtcgtagaaatgtgactgatcataagaaa
ggagcaaaaaaagctagaatcgaagaagacaagaaggaaacggaggacaaaaaagcagat
gttaaggaggaagataaatccaaggataatagtggtgaaaaaacagataccaaaggagcc
aaatcagaacagctcagcaatccttga

DBGET integrated database retrieval system